Difference between revisions of "BGIOSGA033815"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
 
Please input one-sentence summary here.
 
Please input one-sentence summary here.
  

Revision as of 17:11, 5 August 2012

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

BGIOSGA033815

Description

Putative uncharacterized protein

Definition

Oryza sativa Indica Group BGIOSGA033815, complete gene.

LocusTag

OsI_36468

Ensembl Transcript ID

BGIOSGA033815-TA

Ensembl Protein ID

BGIOSGA033815-PA

Length

1042

Source

Oryza sativa Indica Group

 ORGANISM  Oryza sativa Indica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 11

Location

Chromosome 11:17282021..17283062

Sequence Coding Region

17282709..17283062,17282021..17282638

Genome Context

<gbrowseImage1> name=IndicaChromosome11:17282021..17283062 source=RiceIndica11 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=IndicaChromosome11:17282021..17283062 source=RiceIndica11 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>ATGGCGAGCTTGTCGGCGTCGCCGTCGGGGAGGCGGCTGTCGGAGCTGCTGGAGGAGAAGCAGGAGCCGTTCTACCTCGACCTTCACCTGCTGGAGAAGGGGTGCTCGCCGCGGCTGCTCGACGGCTACGACACCGCCGCCGCCGCCGCGGTCATGTGCTGGCCGGCGGCGGCGGCGGCCGGCGGCGGCAACGACGCCGCCGCGTCCGTGCTCAGGCGGCTCACCACCACCACCACCAAGAAGAAGAAGGAGGCGGCGGCGAGGGGCGCGGGCAAGAAGACGACGAAGAAGCCTGCGGCGGCGGCGGCGGCGGCCACCGGGCTCCTCCGCGTCCTCCTCTCCAAGATCCTCCACGTCGCCGGCGCCGCCGCCGCGCCGTCTCCGTGCTCGACCAAGCACCACCCGCTCGACGCCGCCGCCGCCGCCGACGAGAAGGAGGAGGAGATAGAGTACACCGACTCGGAGTCCGACGACGAGAAGCAGTTCAGCCCGGTGTCCGTGCTGGACCACCCGTTCGACTTCGAGAGCTCACCCATCCACAAGCGCTCGCCGTCGCGGGTGGCGCAGCCGCAGGGCTCGCCGAAGAACGCCATGGCGTTCGTCCGCGACCTCCTCGAGGCGGCGTACTCGCCGGCGCTGCTCACCCACCTCCTCTCCAAGACCGACGACCTCATCAACGCCACGGCCGACGCCGCCGCCGCCGCCGCCTCCGACGACGACGACGACGACGACTGCTGCTACCACCACGAGAGCGACGGCGGCGAGCTCGCCCCCGCCGCCGCGTACTGGGAGGCGCAGAGGGCGGAGCTAACCAGGGTGTCGGCGATGGTGGCGTCGGAGGTGCCGAGCTCGTCGCGGATCGGCGCCGCCGACGTGCGGCCGGAGCGGGACGGCGTCGGCGCCGACCTCGAGGCCGCCGTGCTCGACCAGCTCCTGCACGAGCTCGCCGTGGAGCTCGCCGGCGGCCGCTGA</cdnaseq>

Protein Sequence

<aaseq>MASLSASPSGRRLSELLEEKQEPFYLDLHLLEKGCSPRLLDGYDTAAAAAVMCWPAAAAAGGGNDAAASVLRRLTTTTTKKKKEAAARGAGKKTTKKPAAAAAAATGLLRVLLSKILHVAGAAAAPSPCSTKHHPLDAAAAADEKEEEIEYTDSESDDEKQFSPVSVLDHPFDFESSPIHKRSPSRVAQPQGSPKNAMAFVRDLLEAAYSPALLTHLLSKTDDLINATADAAAAAASDDDDDDDCCYHHESDGGELAPAAAYWEAQRAELTRVSAMVASEVPSSSRIGAADVRPERDGVGADLEAAVLDQLLHELAVELAGGR</aaseq>

Gene Sequence

<dnaseqindica>1..354#425..1042#ATGGCGAGCTTGTCGGCGTCGCCGTCGGGGAGGCGGCTGTCGGAGCTGCTGGAGGAGAAGCAGGAGCCGTTCTACCTCGACCTTCACCTGCTGGAGAAGGGGTGCTCGCCGCGGCTGCTCGACGGCTACGACACCGCCGCCGCCGCCGCGGTCATGTGCTGGCCGGCGGCGGCGGCGGCCGGCGGCGGCAACGACGCCGCCGCGTCCGTGCTCAGGCGGCTCACCACCACCACCACCAAGAAGAAGAAGGAGGCGGCGGCGAGGGGCGCGGGCAAGAAGACGACGAAGAAGCCTGCGGCGGCGGCGGCGGCGGCCACCGGGCTCCTCCGCGTCCTCCTCTCCAAGATCCTCCACGTCAAGGCGGCTAGCAACGGGGAAGCCTGGTGGCGCTTCAATCGTCGGAGTCGATTCAGCTTCAAGTAAGGTCGCCGGCGCCGCCGCCGCGCCGTCTCCGTGCTCGACCAAGCACCACCCGCTCGACGCCGCCGCCGCCGCCGACGAGAAGGAGGAGGAGATAGAGTACACCGACTCGGAGTCCGACGACGAGAAGCAGTTCAGCCCGGTGTCCGTGCTGGACCACCCGTTCGACTTCGAGAGCTCACCCATCCACAAGCGCTCGCCGTCGCGGGTGGCGCAGCCGCAGGGCTCGCCGAAGAACGCCATGGCGTTCGTCCGCGACCTCCTCGAGGCGGCGTACTCGCCGGCGCTGCTCACCCACCTCCTCTCCAAGACCGACGACCTCATCAACGCCACGGCCGACGCCGCCGCCGCCGCCGCCTCCGACGACGACGACGACGACGACTGCTGCTACCACCACGAGAGCGACGGCGGCGAGCTCGCCCCCGCCGCCGCGTACTGGGAGGCGCAGAGGGCGGAGCTAACCAGGGTGTCGGCGATGGTGGCGTCGGAGGTGCCGAGCTCGTCGCGGATCGGCGCCGCCGACGTGCGGCCGGAGCGGGACGGCGTCGGCGCCGACCTCGAGGCCGCCGTGCTCGACCAGCTCCTGCACGAGCTCGCCGTGGAGCTCGCCGGCGGCCGCTGA</dnaseqindica>

External Link(s)

EnsemblPlants:BGIOSGA033815