Difference between revisions of "AtpH"
(Created page with "{{Plastid| GeneName = atpH| Description = ATP synthase CF0 C subunit| Version = GeneID:3131392| Length = 246 bp| Definition = Oryza sativa Japonica Group ''atpH'', Plastid gen...") |
|||
| Line 15: | Line 15: | ||
AP = Plastid:32039..32284| | AP = Plastid:32039..32284| | ||
CDS = 32039..32284| | CDS = 32039..32284| | ||
| − | GCID = < | + | GCID = <gbrowseImage3> |
name=NC_001320:32039..32284 | name=NC_001320:32039..32284 | ||
source=Rice_Japonica_Plastid | source=Rice_Japonica_Plastid | ||
preset=GeneLocation | preset=GeneLocation | ||
| − | </ | + | </gbrowseImage3>| |
GSID = <gbrowseImage2> | GSID = <gbrowseImage2> | ||
name=NC_001320:32039..32284 | name=NC_001320:32039..32284 | ||
Revision as of 09:37, 30 August 2012
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
atpH |
|---|---|
| Description |
ATP synthase CF0 C subunit |
| Version |
GeneID:3131392 |
| Length |
246 bp |
| Definition |
Oryza sativa Japonica Group atpH, Plastid gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Plastid:32039..32284 |
| Sequence Coding Region |
32039..32284 |
| Genome Context |
<gbrowseImage3> name=NC_001320:32039..32284 source=Rice_Japonica_Plastid preset=GeneLocation </gbrowseImage3> |
| Gene Structure |
<gbrowseImage2> name=NC_001320:32039..32284 source=Rice_Japonica_Plastid preset=GeneLocation </gbrowseImage2> |
| Protein Sequence |
<aaseq>MNPLIAAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLFANPFV</aaseq> |
| Gene Sequence |
<dnaseqindica>1..246#atgaatccactaattgctgctgcttccgttattgctgctggattggccgtaggtcttgcttctattgggcctggagttggtcaaggtactgctgcaggacaagctgtagaaggtattgcgagacagccagaagcagaaggtaaaatacgcggtactttattgcttagtctagcttttatggaagctttaacaatttatggactagttgtggcactggcgcttttatttgcgaacccttttgtttaa</dnaseqindica> |
| External Link(s) |
{{{Link}}} |