Difference between revisions of "PsbI"
(Created page with "{{Plastid| GeneName = psbI| Description = photosystem II protein I| Version = GeneID:3131416| Length = 111 bp| Definition = Oryza sativa Japonica Group ''psbI'', Plastid gene....") |
|||
| Line 15: | Line 15: | ||
AP = Plastid:7608..7718| | AP = Plastid:7608..7718| | ||
CDS = 7608..7718| | CDS = 7608..7718| | ||
| − | GCID = < | + | GCID = <gbrowseImage3> |
name=NC_001320:7608..7718 | name=NC_001320:7608..7718 | ||
source=Rice_Japonica_Plastid | source=Rice_Japonica_Plastid | ||
preset=GeneLocation | preset=GeneLocation | ||
| − | </ | + | </gbrowseImage3>| |
GSID = <gbrowseImage2> | GSID = <gbrowseImage2> | ||
name=NC_001320:7608..7718 | name=NC_001320:7608..7718 | ||
| Line 27: | Line 27: | ||
AA = <aaseq>MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGRDE</aaseq>| | AA = <aaseq>MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGRDE</aaseq>| | ||
DNA = <dnaseqindica>1..111#atgcttactctcaaactttttgtttatacagtagtgatattctttgtttccctctttatctttggattcttatctaatgatccaggacgtaatcctgggcgtgacgagtaa</dnaseqindica>| | DNA = <dnaseqindica>1..111#atgcttactctcaaactttttgtttatacagtagtgatattctttgtttccctctttatctttggattcttatctaatgatccaggacgtaatcctgggcgtgacgagtaa</dnaseqindica>| | ||
| + | Link = [http://www.ncbi.nlm.nih.gov/gene?term=3131416 NCBI Gene:psbI] | ||
}} | }} | ||
[[Category:Genes]] | [[Category:Genes]] | ||
Revision as of 10:08, 27 October 2012
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
psbI |
|---|---|
| Description |
photosystem II protein I |
| Version |
GeneID:3131416 |
| Length |
111 bp |
| Definition |
Oryza sativa Japonica Group psbI, Plastid gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Plastid:7608..7718 |
| Sequence Coding Region |
7608..7718 |
| Genome Context |
<gbrowseImage3> name=NC_001320:7608..7718 source=Rice_Japonica_Plastid preset=GeneLocation </gbrowseImage3> |
| Gene Structure |
<gbrowseImage2> name=NC_001320:7608..7718 source=Rice_Japonica_Plastid preset=GeneLocation </gbrowseImage2> |
| Protein Sequence |
<aaseq>MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGRDE</aaseq> |
| Gene Sequence |
<dnaseqindica>1..111#atgcttactctcaaactttttgtttatacagtagtgatattctttgtttccctctttatctttggattcttatctaatgatccaggacgtaatcctgggcgtgacgagtaa</dnaseqindica> |
| External Link(s) |
