Difference between revisions of "Os08g0162100"

From RiceWiki
Jump to: navigation, search
(References)
(Mutation)
Line 4: Line 4:
 
===Function===
 
===Function===
 
This gene plays an important role in male gametophyte formation and the first internode elongation in rice<ref name="ref1" />. As a transcriptional co-repressor it repress a number of genes to regulates various aspects of developmental processes and physiological responses<ref name="ref2" />. Its function in branch formation regulation is likely by suppressing primary branch formation and promoting secondary branch formation<ref name="ref3" />.
 
This gene plays an important role in male gametophyte formation and the first internode elongation in rice<ref name="ref1" />. As a transcriptional co-repressor it repress a number of genes to regulates various aspects of developmental processes and physiological responses<ref name="ref2" />. Its function in branch formation regulation is likely by suppressing primary branch formation and promoting secondary branch formation<ref name="ref3" />.
===Mutation===
+
===Wild Type VS. Mutant===
 
* At the harvest stage, the height of the ''Oslis-l1-1'' mutant plants was only 48.9 cm, whereas WT plants had a height of 87.3 cm. (Fig. 1a).<br>
 
* At the harvest stage, the height of the ''Oslis-l1-1'' mutant plants was only 48.9 cm, whereas WT plants had a height of 87.3 cm. (Fig. 1a).<br>
 
* The semi-dwarf phenotype of ''Oslis-l1-1'' was partially due to its panicle length being shortened to 12.1 cm from 20.5 cm in WT.(Fig. 1b).<br>  
 
* The semi-dwarf phenotype of ''Oslis-l1-1'' was partially due to its panicle length being shortened to 12.1 cm from 20.5 cm in WT.(Fig. 1b).<br>  
 
* The retarded vegetative growth also accompanied by smaller florets (Fig. 1c, d) and very low fertility. In contrast to the WT seed-setting rate (81.4%), the seedsetting rate of ''Oslis-l1-1'' mutant was only 11.3% in the same normal field conditions.<br>
 
* The retarded vegetative growth also accompanied by smaller florets (Fig. 1c, d) and very low fertility. In contrast to the WT seed-setting rate (81.4%), the seedsetting rate of ''Oslis-l1-1'' mutant was only 11.3% in the same normal field conditions.<br>
 
* The 10-seed length and width of oslis-l1-1 was only 84.9 and 70.4% of the WT, respectively (Fig. 1e, f)<ref name="ref1" />.
 
* The 10-seed length and width of oslis-l1-1 was only 84.9 and 70.4% of the WT, respectively (Fig. 1e, f)<ref name="ref1" />.
 +
 
===Expression===
 
===Expression===
 
* qRT-PCR analyses by ''Gao X et al.'' shows that '''''OsLIS-L1''''' transcript had a relatively higher abundance in stem and panicles at the heading stage, though other tissues at the same stage such as root, leaf, and sheath also showed weak expression of '''''OsLIS-L1'''''. This expression pattern of '''''OsLISL1''''' supported its function for internode elongation and panicle development in rice<ref name="ref1" />.
 
* qRT-PCR analyses by ''Gao X et al.'' shows that '''''OsLIS-L1''''' transcript had a relatively higher abundance in stem and panicles at the heading stage, though other tissues at the same stage such as root, leaf, and sheath also showed weak expression of '''''OsLIS-L1'''''. This expression pattern of '''''OsLISL1''''' supported its function for internode elongation and panicle development in rice<ref name="ref1" />.

Revision as of 15:22, 29 March 2013

The rice Os08g0162100 was reported as Lissencephalytype-1-like 1(OsLIS-L1)[1], ABERRANT SPIKELET AND PANICLE1(ASP1)[2] and Oryza RAMOSA1 ENHANCER LOCUS2(OsREL2)[3] respectively in 2012 by scientsits from China, Japan and Korea(in chronological order).

Annotated Information

Figure 1. Oslis-l1 mutant VS. WT(from reference) [1].

Function

This gene plays an important role in male gametophyte formation and the first internode elongation in rice[1]. As a transcriptional co-repressor it repress a number of genes to regulates various aspects of developmental processes and physiological responses[2]. Its function in branch formation regulation is likely by suppressing primary branch formation and promoting secondary branch formation[3].

Wild Type VS. Mutant

  • At the harvest stage, the height of the Oslis-l1-1 mutant plants was only 48.9 cm, whereas WT plants had a height of 87.3 cm. (Fig. 1a).
  • The semi-dwarf phenotype of Oslis-l1-1 was partially due to its panicle length being shortened to 12.1 cm from 20.5 cm in WT.(Fig. 1b).
  • The retarded vegetative growth also accompanied by smaller florets (Fig. 1c, d) and very low fertility. In contrast to the WT seed-setting rate (81.4%), the seedsetting rate of Oslis-l1-1 mutant was only 11.3% in the same normal field conditions.
  • The 10-seed length and width of oslis-l1-1 was only 84.9 and 70.4% of the WT, respectively (Fig. 1e, f)[1].

Expression

  • qRT-PCR analyses by Gao X et al. shows that OsLIS-L1 transcript had a relatively higher abundance in stem and panicles at the heading stage, though other tissues at the same stage such as root, leaf, and sheath also showed weak expression of OsLIS-L1. This expression pattern of OsLISL1 supported its function for internode elongation and panicle development in rice[1].
  • In situ hybridization analyse by Yoshida A et al. shows that this gene has a dynamic expression pattern at different developmental stages. In the reproductive phase, strong expression was initially detected in the IM and the bract primordia, and then in the primary and secondary BMs. In the seedling stage, its transcript was detected in leaf primordia, but no or very weak expression was detected in the SAM. In later stages of the vegetative phase, its transcript was detected in the AM and the primordia of the crown root[2].

Protein Structure

Figure 2. Protein Structure of OsLIS-L1 (from reference) [2].

OsLIS-L1(OsASP1 or OsREL2) is a very large gene of approximately 8.7 kb that comprises 25 exons. It encodes a protein with a lissencephaly type 1-like homology (LisH) domain and a C-terminal to LisH (CTLH) domain in its N-terminal region, and 11 repeats of WD40 domains in its middle and C-terminal regions[2]. The domain organization and protein sequence of this gene are very similar to those of TOPLESS (TPL) (BX817862) in Arabidopsis and REL2 (GQ927145 and GQ927146) in maize, which are putative transcriptional co-repressors[2].

Homologues

OsLIS-L1 has two homologues in rice: Os01g0254100 and Os03g0254700[1][3]. The cDNA of Os01g15020 and Os03g14980 shared 36% and 39% nucleotide identity with OsLIS-L1, respectively; the Os01g15020 polypeptide shared 62% identity and the Os03g14980 polypeptide shared 67% identity with OsLISL1[1].

  • Os01g15020 and Os03g14980 also contain four recognizable structural domains similar to OsLIS-L1: starting from the N terminus, they are the LisH, CTLH, the WD40-repeat domain in the middle, and the WD40-repeat domain at the C terminus[1].
  • However, OsLIS-L1 has a five WD40-repeat domain in the middle, but Os01g15020 and Os03g14980 both have a six WD40-repeat domain in the middle; OsLIS-L1 and Os03g14980 both have a four WD40-repeat domain at the C terminus, whereas Os01g15020 has a five WD40-repeat domain at the C terminus[1].

Labs working on this gene

  • National Key Laboratory of Crop Genetic Improvement and National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China
  • Department of Life Science, Sogang University, Mapo-gu, Seoul 121-742, Korea
  • Graduate School of Biotechnology and Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea
  • Department of PrePharmMed, Duksung Women’s University, Seoul 132-714, Korea
  • Department of Biological Sciences, Graduate School of Science, The University of Tokyo, Hongo, Bunkyo-ku, Tokyo113-8657, Japan
  • Bioscience and Biotechnology Center, Nagoya University, Chikusa, Nagoya 464-8601, Japan
  • National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 Gao X, Chen Z, Zhang J, et al. OsLIS-L1 encoding a lissencephaly type-1-like protein with WD40 repeats is required for plant height and male gametophyte formation in rice[J]. Planta, 2012, 235(4): 713-727.
  2. 2.0 2.1 2.2 2.3 2.4 2.5 Yoshida A, Ohmori Y, Kitano H, et al. ABERRANT SPIKELET AND PANICLE1, encoding a TOPLESS‐related transcriptional co‐repressor, is involved in the regulation of meristem fate in rice[J]. The Plant Journal, 2012, 70(2): 327-339.
  3. 3.0 3.1 3.2 Kwon Y, Yu S, Park J, et al. OsREL2, a rice TOPLESS homolog functions in axillary meristem development in rice inflorescence[J]. Plant biotechnology reports, 2012, 6(3): 213-224.

Structured Information

Gene Name

Os08g0162100

Description

Similar to CTV.2

Version

NM_001067590.1 GI:115474916 GeneID:4344728

Length

8681 bp

Definition

Oryza sativa Japonica Group Os08g0162100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 8

Location

Chromosome 8:3666095..3674775

Sequence Coding Region

3666651..3666730,3666841..3667020,3667104..3667217,3667322..3667480,3668185..3668365
,3668449..3668575,3668669..3668778,3668876..3669014,3669114..3669223
,3669349..3669418,3669594..3669667,3669805..3669900,3670029..3670124
,3670388..3670515,3670769..3671003,3671090..3671257,3671621..3671728
,3671815..3671964,3672252..3672362,3672465..3672644,3672774..3672902
,3673166..3673261,3673455..3673640,3673778..3673950,3674067..3674268

Expression

GEO Profiles:Os08g0162100

Genome Context

<gbrowseImage1> name=NC_008401:3666095..3674775 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008401:3666095..3674775 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtcgtcgcttagcagggagctggttttcctcatcctgcagttcctcgatgaggagaagttcaaggagacggtgcacaagttggagcaggagtcggccttctacttcaacatgaagcactttgaagacctggtgcagggaggggagtgggacgaggtggagaagtacctcagcgggttcaccaaggtggaggacaaccgctactccatgaaaatattcttcgagatccggaagcagaagtacctcgaagcccttgacaggcatgatcgagccaaggcggtggagatactcgtgaaggatctcaaggtgtttgcctcattcaatgaggagctgttcaaggagataacacagctgctgacgttggagaattttaggcaaaatgagcagctgtccaagtatggggacacaaagtcagctcggaatatcatgctcatggagctcaagaagcttattgaggcaaacccactgtttcgggacaagctgaatttcccaccatttaaagtttcaagactccgcacattaatcaatcaaagtcttaactggcaacatcagctatgcaagaatcccagaccaaaccctgacatcaagacactgtttaccgatcattcttgtgccgctcctaccaatggagcaagagctcctccccctgctaatgggcctcttgttggaccaatccctaagtcagctgcatttcctccaatgggtgctcatgcgccatttcaacctgtggtgtcaccatctccaaatgcaattgcgggttggatgacaaatgcgaacccctctttgccacatgctgcagtcgcacaaggaccacctggtcttgttcaacctccaaacacagcggcatttctaaaacatccaaggactccaacaagtgctcctgccattgattatcaatctgcggattctgaacatctgatgaaaagaatgcgtgtaggccaaccagatgaggtgtccttctctggtgcaagccaccctgccaacatttatactcaagatgaccttccaaaacaagttgttcgcaaccttaaccagggttcaaatgttatgagcctggatttccatcctgttcaacaaaccatccttctagttggaacaaatgttggtgacattgggatatgggaagttggctcacgagaaaggatagctcacaagacattcaaagtttgggatattagttcttgcaccttgcctttgcaggctgcactgatgaaagatgctgcaatatctgtcaatagatgcctgtggagtcctgatggaagtattttaggtgttgctttttcaaagcatattgttcagacgtatgcattcgtgctcaatggagaattgcggcagcaagcagagattgatgcccacattggtggggttaatgatattgccttctctcaccccaacaagaccctctcaattattacttgtggtgatgataaactaattaaggtatgggatgctcagacaggacaaaagcagtacacatttgaaggtcacgaagctccagtatattctgtttgccctcactacaaggagtcaattcagtttatattctctactgccatcgatgggaaaattaaggcatggttatatgactgtttgggctcaagggttgactatgatgctcctggacattggtgtactaccatggcttacagtgctgatggaacaaggctcttctcatgtggtactagcaaagatggtgattcacacttggttgagtggaatgagactgagggagctattaagaggacatacaatggtttcaggaagcgctcactgggtgttgtccagtttgatacaacaagaaaccgcttcttggctgctggagatgaattcgttgttaaattctgggatatggataacaccaacatacttacaacaacagattgtgacggtggactgcctgcgagcccacgcttgagattcaacagagaaggttcattgcttgctgttacagcaaatgaaaatggaataaaaatattagccaacactgatggacagcgtttgctaaggatgctagagagcagagcatatgagggctctcgagggccacctcaacaaattaataccaagcccccaattgtcaacacccttggttctgtttccaatgtgtctagtcctatggcagtgaattcggagagacctgatcgggcattgcccacagtgtcaatgagtggcctggcgcccatggatgttagcagaaccccagatgttaagccaagaattacagatgaatctgaaaaggttaaaacctggaagttggcagacattggtgactcaggacatctccgagcactgcgtatgccggatacatcagcaacttcaagcaaagttgtgcgtctgctgtatacaaataatggggttgcgcttttggctcttggctctaatgctgttcataagctgtggaaatggcaacgcactgataggaatcctaatggcaagtccactgcatctttcactcctcaaatgtggcaaccagcaaatgggattcttatggcaaatgacactagtgatggcaaccccgaagaagcaactgcctgcattgctctgtccaaaaatgattcctatgtgatgtctgcatccggtggcaaagtctcattgttcaacatgatgacattcaaggtcatgactactttcatggcacctccacctgctgcaactttccttgcattccaccctcaagacaataatatcattgctattggaatggaggactctaccattcaaatttataatgtccgtgttgacgaggttaaaagcaagcttaagggacattcaaaaaagatcactgggctggcattttcgcagtcaatgaatatgcttgtatcttcaggtgctgatgctcagctatgtgcttggagcattgatggttgggaaaagaagaaatcaagatatatccaatctccagcaaatcgttctggtgctttagttggtgatacaagggtgcagtttcacaatgaccaaacacatattttggtggttcatgagagccagttggcgatctatgatgcaaagctagagtgcttgcgctcgtggtccccaagagaagcactccctgctccaatttcaagtgcaatatactcatgtgatggtctcctcatctacgccggattttgtgatggtgcaattggagtcttcgaagcagagtctcttaggctgcgatgcaggatagcaccttctgcatacataccaccttccatgtctagtggtggaagtgtttaccccatggttgtcgctgcgcatcccttggagcctaaccagattgcggtcggcatgagcgatggtgctgttcatgtggtggagccgttggactcagacccaaagtggggagtggcgcctcctcaagacaatggaacccaccccacaatatcagcggctccggcagcagctaacaaaccagaagtctga</cdnaseq>

Protein Sequence

<aaseq>MSSLSRELVFLILQFLDEEKFKETVHKLEQESAFYFNMKHFEDL VQGGEWDEVEKYLSGFTKVEDNRYSMKIFFEIRKQKYLEALDRHDRAKAVEILVKDLK VFASFNEELFKEITQLLTLENFRQNEQLSKYGDTKSARNIMLMELKKLIEANPLFRDK LNFPPFKVSRLRTLINQSLNWQHQLCKNPRPNPDIKTLFTDHSCAAPTNGARAPPPAN GPLVGPIPKSAAFPPMGAHAPFQPVVSPSPNAIAGWMTNANPSLPHAAVAQGPPGLVQ PPNTAAFLKHPRTPTSAPAIDYQSADSEHLMKRMRVGQPDEVSFSGASHPANIYTQDD LPKQVVRNLNQGSNVMSLDFHPVQQTILLVGTNVGDIGIWEVGSRERIAHKTFKVWDI SSCTLPLQAALMKDAAISVNRCLWSPDGSILGVAFSKHIVQTYAFVLNGELRQQAEID AHIGGVNDIAFSHPNKTLSIITCGDDKLIKVWDAQTGQKQYTFEGHEAPVYSVCPHYK ESIQFIFSTAIDGKIKAWLYDCLGSRVDYDAPGHWCTTMAYSADGTRLFSCGTSKDGD SHLVEWNETEGAIKRTYNGFRKRSLGVVQFDTTRNRFLAAGDEFVVKFWDMDNTNILT TTDCDGGLPASPRLRFNREGSLLAVTANENGIKILANTDGQRLLRMLESRAYEGSRGP PQQINTKPPIVNTLGSVSNVSSPMAVNSERPDRALPTVSMSGLAPMDVSRTPDVKPRI TDESEKVKTWKLADIGDSGHLRALRMPDTSATSSKVVRLLYTNNGVALLALGSNAVHK LWKWQRTDRNPNGKSTASFTPQMWQPANGILMANDTSDGNPEEATACIALSKNDSYVM SASGGKVSLFNMMTFKVMTTFMAPPPAATFLAFHPQDNNIIAIGMEDSTIQIYNVRVD EVKSKLKGHSKKITGLAFSQSMNMLVSSGADAQLCAWSIDGWEKKKSRYIQSPANRSG ALVGDTRVQFHNDQTHILVVHESQLAIYDAKLECLRSWSPREALPAPISSAIYSCDGL LIYAGFCDGAIGVFEAESLRLRCRIAPSAYIPPSMSSGGSVYPMVVAAHPLEPNQIAV GMSDGAVHVVEPLDSDPKWGVAPPQDNGTHPTISAAPAAANKPEV</aaseq>

Gene Sequence

<dnaseqindica>557..636#747..926#1010..1123#1228..1386#2091..2271#2355..2481#2575..2684#2782..2920#3020..3129#3255..3324#3500..3573#3711..3806#3935..4030#4294..4421#4675..4909#4996..5163#5527..5634#5721..5870#6158..6268#6371..6550#6680..6808#7072..7167#7361..7546#7684..7856#7973..8174#aatcgggtccaaaaaaaccaaaagcaaagaggaaaataaaagcgagaggagtttcggagagagaaagtgagaggaggaggaggagagagaagagaagagagataagaggaggagaaggcgaacgcggcggctaggtggagaggagaggaaggaagggagcaaacgaaggcggcggcggaaccctagccggaggcgggaggaggggggagacgcgaggtgtctctctggctggtcggattcggccggccgggaggcgtcagatcggtggtcgggccgccggagacggaggagatccggggcatgggcgtggcgacgggggcgggagggtcgtcgtgagctttctgccgccgtcggtttcggcttgagctctgggtttattaattttttttggggttgctgctgttttttttgtggaggtttgagttggtgaggggggtggtttggtgcgcccgtttgaggtggtttttgaggggatttgggagggggatctgccgcggaagcggggtttttagttcggctttgagagctggaggcgcaggctgggatcggcggagccatgtcgtcgcttagcagggagctggttttcctcatcctgcagttcctcgatgaggagaagttcaaggagacggtgcacaagtaagcgtgtttttcggttgattggagtgagggattttgagccattttgttggtgaatatggtttttgattgtttcccattcgtttttggggttatttcggtcggtttaggttggagcaggagtcggccttctacttcaacatgaagcactttgaagacctggtgcagggaggggagtgggacgaggtggagaagtacctcagcgggttcaccaaggtggaggacaaccgctactccatgaaaatattcttcgagatccggaagcagaagtacctcgaagcccttgacaggtaattcattggaagcttgtaatggtggttggctgatggcaacgtgaaattgtgctgagttggattttgttttttggttgcaggcatgatcgagccaaggcggtggagatactcgtgaaggatctcaaggtgtttgcctcattcaatgaggagctgttcaaggagataacacagctgctgacgttggagaattttaggtatgttggtgatgattagtttatagcattttgattgagtaaaatgcccagtgcattggagtaagataaatgtgatagtgtattaatgatgaacacttgaacaggcaaaatgagcagctgtccaagtatggggacacaaagtcagctcggaatatcatgctcatggagctcaagaagcttattgaggcaaacccactgtttcgggacaagctgaatttcccaccatttaaagtttcaagactccgcacattaatcaatcaaaggtgtttggttgatttaagttttggcatgtttttaaattctgtcttttttgttttctcagggatgtgatctgcatgaacaacaatgttaatattcaaataggaaatgctccgtgagccgcattaaattcgcataatgccagcttaaggtttcagtggcacatatattcgtgtatatatgcttttgtgtttggaaaagaatttgtcaccgaaatgatataggtggtttagttttctgtctggtcacaataccatctttgcttggcaacgatgaatacgtaaggaagaggcgtgtgttgtttatatatggaaactacacggctttttaagcatctaacagcttttaggtgacatttatagttcttgattgtccagtaatgaatgggcatgctccaaccaatatgttcggaaattatgagtgatgtttgcctacatacatttatctctcccaattagcatgctctaatggaatacgccaaatatgctgaggttaaatagtatagtaataaattatgttttttcagtgttcttttctaactattgatgctcatgtggatctcctatttgatatttttcatcatcaactactttgtgttttgctgttccgtaatgtagacctgttaggttttctctatgaattatcttccttcagtttcttgtaaaagcatgatgctaattggggtgcgtttctttcttatgtcttgtagtcttaactggcaacatcagctatgcaagaatcccagaccaaaccctgacatcaagacactgtttaccgatcattcttgtgccgctcctaccaatggagcaagagctcctccccctgctaatgggcctcttgttggaccaatccctaagtcagctgcatttcctccaatgggtgctcatgcggtaaggattagattactaccagtaaatagtgcattttattttacactcatctgttactcaagtttcaatcttgattcttgcagccatttcaacctgtggtgtcaccatctccaaatgcaattgcgggttggatgacaaatgcgaacccctctttgccacatgctgcagtcgcacaaggaccacctggtcttgttcaacctccaaacacaggtgagataaacctaaagtaattcagctaactggttgctgtcactggtagcattgagtttgactgtttgcttggattatatatctcctttgcagcggcatttctaaaacatccaaggactccaacaagtgctcctgccattgattatcaatctgcggattctgaacatctgatgaaaagaatgcgtgtaggccaaccagatgaggtatctaatgattttgcatttattgtgtttatcctcttcactattgtctgcagatttgcatgctaaataaattacgatgcattgaaaactatgctaggtgtccttctctggtgcaagccaccctgccaacatttatactcaagatgaccttccaaaacaagttgttcgcaaccttaaccagggttcaaatgttatgagcctggatttccatcctgttcaacaaaccatccttctaggtacatactggaaacacatctgttcgttttcttttaaaactctttgtccatgttctgtccactatatttactgtgttcttgacttctcgtgtaacacagttggaacaaatgttggtgacattgggatatgggaagttggctcacgagaaaggatagctcacaagacattcaaagtttgggatattagttcttgcaccttgcctttgcaggtgacttgcatgatattcttgatctatttttgtgcactaattaccttcttttgttcttctactagcagtatgccgttttcttcttgtgatgtattctaatgctcaatctgtcttaccatgtccaggctgcactgatgaaagatgctgcaatatctgtcaatagatgcctgtggagtcctgatggaagtattttaggtcagaagatctgttcattgtggtatcattcacattttggcatgccatcttagataaatgcaacatttgtgcattgctctgacttgtagtgttttgttttaatgtttcctcgggtggagagattgaattacccccgtctgcaatattgtttcaataagtttgatttgattctcaggtgttgctttttcaaagcatattgttcagacgtatgcattcgtgctcaatggagaattgcggcagcaagcagaggtatatccatacatggatgcttcttaagaataaatatgaatgccttttgcatgtttggattagtgggatgggattttgttcaatgctgctcatcgaaacacttcctgaaaggtttctaactcttgcaaatggcacagattgatgcccacattggtggggttaatgatattgccttctctcaccccaacaagaccctctcaattattacttgtggtgatgataaactaattaaggtgaggtcgttgatatgatacactgcttcaccctttcttgagaaaaagaaatgaacaccatattcatatgatacattgctttatcctcttgaaaaaatgaaccatggatgcacatttgattttggcaggtatgggatgctcagacaggacaaaagcagtacacatttgaaggtcacgaagctccagtatattctgtttgccctcactacaaggagtcaattcaggtatttcaggaatacttcaatttactttcttaggatatgcttctgccgttttaatttgcaatgcgttgtggatctaatctttctggttagtgcatttcattgccattttcatgataaatatgcttattgcattcttggttagcattagtattgcatgttgatttgctttgattttgacatatgcaaaggtagactatgtattatcttttctactattatctgttatatccaatgcatttctttaacattcgttttctttgcagtttatattctctactgccatcgatgggaaaattaaggcatggttatatgactgtttgggctcaagggttgactatgatgctcctggacattggtgtactaccatggcttacagtgctgatggaacaaggtgatgagacactgcaaatgaatatcagctgctaattgttcaagacaataatatagtttctaaaccttcacaaattaagtgaatatattgaataaatagtatagttgtcaggcaggaacaaattaaaatgagaatatgttgcagggtgaaggatatacattttatcgtagcttctctagttgcaatttgttttgtcactccatttcacactttgtatctgtgcgagttgtttgattgtaaattttccctgcaggctcttctcatgtggtactagcaaagatggtgattcacacttggttgagtggaatgagactgagggagctattaagaggacatacaatggtttcaggaagcgctcactgggtgttgtccagtttgatacaacaagaaaccgcttcttggctgctggagatgaattcgttgttaaattctgggatatggataacaccaacatacttacaacaacagattgtgacggtggactgcctgttagtatagtttctcctagtatcatgttgtcggaatcatctacacttaaggttttgtgcttaacctcatgctaataattttgcaggcgagcccacgcttgagattcaacagagaaggttcattgcttgctgttacagcaaatgaaaatggaataaaaatattagccaacactgatggacagcgtttgctaaggatgctagagagcagagcatatgagggctctcgagggccacctcaacaaattaataccaaggtattgatgcatatacttaccatttttttaatgttcccttaaatcctagtgtcattagggtataaagataacattgattcgcgtattcggaaaaaaagataacattgtttctgttctctattataaccttgttttctgatatatctttttttttggttccgtcatctgaaaactggtttgggcctatggctgtttcctgttttctgaagcttcaaaaccactagtatctattcgtttgtaagatgcagcacggtgttctgggcaactgtttagactttagttagtttcaatcaagctgccttgtgttattttcagtgctggctgataatgttgactataacctcatttttgttcttattgtagcccccaattgtcaacacccttggttctgtttccaatgtgtctagtcctatggcagtgaattcggagagacctgatcgggcattgcccacagtgtcaatgagtggcctggtgagtttgcagaatctattttgttgtctgctcactgttcaatacttcaacctgttctgttgctaaatgcatcaaacaaataccaggcgcccatggatgttagcagaaccccagatgttaagccaagaattacagatgaatctgaaaaggttaaaacctggaagttggcagacattggtgactcaggacatctccgagcactgcgtatgccggatacatcagcaacttcaagcaaagtatgttgaacaatgtgtgcttggttgctatcaagtctgttgagttataaatattgatcatgcaataataacctgattaccttaaacatatgagcttgtctttctgtttaatgtctggaagaccgcagtatctgttggtgtttacatgcaattgttgcacaaatgtcaagttttgacctttttttgtcaacatttgataggatcttttttcagtgatagaacaggctgttcagttctgagcaatatgaaatttctgataagcactgtaatttttttttgttgcacaggttgtgcgtctgctgtatacaaataatggggttgcgcttttggctcttggctctaatgctgttcataagctgtggaaatggcaacgcactgataggaatcctaatggcaaggttagagtggagagttgttcttatttggatttcatctgttcttatttggatttcatctgctattctgtttgcttggtttctaaatatatgcatatattgtagtccactgcatctttcactcctcaaatgtggcaaccagcaaatgggattcttatggcaaatgacactagtgatggcaaccccgaagaagcaactgcctgcattgctctgtccaaaaatgattcctatgtgatgtctgcatccggtggcaaagtctcattgttcaacatgatgacattcaaggtatatgatctcttcggtgtgtagcacaatcaattgttattaccctagagcataggtcatgagttactttccataaaaatatgtgttattctatagttgtgacgttaaaatttttgaattttttcacaggtcatgactactttcatggcacctccacctgctgcaactttccttgcattccaccctcaagacaataatatcattgctattggaatggaggactctaccattcaaatttataatgtccgtgttgacgaggtgagtgatattctcttaatggttctcaccgcaagtgattaaactagtcaaataatgtttctcatttcctcttaccagatgaatcagatcttgtgagattttgtagatgacgttttagatatatgtatttttttttttacttataaaccttatgtgcaatagaaatgctcagtgaccttcaactaactgaagattaaaatttaaacagctgagaacttgtttcagtgataattgattccttctgtcttaaccatatggcataggttaaaagcaagcttaagggacattcaaaaaagatcactgggctggcattttcgcagtcaatgaatatgcttgtatcttcaggtgctgatgctcaggtatgaattttcctatatattgtgcagaattaaatgtcactttgtgtgcatacttcatcctccatgctcttgttagtcccatgtctagccatcctttagcctgttttgttaaaaaaaaaagattctgatcgcggtggcaagtggactatatatttgtttctgaatcaatggtcattggaatggaattttgcagctatgtgcttggagcattgatggttgggaaaagaagaaatcaagatatatccaatctccagcaaatcgttctggtgctttagttggtgatacaagggtgcagtttcacaatgaccaaacacatattttggtggttcatgagagccagttggcgatctatgatgcaaagctagagtgcttgcgctcggttagttctcagattaccgtaatttaatatatgcatgtattatattacatcgtgctagtgtgataaacatttgtgatccattcaatcaatcattgtattatgatagttgaatttgacctcattgcttgatcatgcagtggtccccaagagaagcactccctgctccaatttcaagtgcaatatactcatgtgatggtctcctcatctacgccggattttgtgatggtgcaattggagtcttcgaagcagagtctcttaggctgcgatgcaggatagcaccttctgcatacataccaccttccatgtctaggtatgtatagtcccctacatgcctacactgctttgtgtttctgttgggtatggtaatcttagtcctggcgaccatcatgttattgttgatgcccatttttgcatcttttccaacagtggtggaagtgtttaccccatggttgtcgctgcgcatcccttggagcctaaccagattgcggtcggcatgagcgatggtgctgttcatgtggtggagccgttggactcagacccaaagtggggagtggcgcctcctcaagacaatggaacccaccccacaatatcagcggctccggcagcagctaacaaaccagaagtctgaccatccctctagtgacttggccagcagtgccgacattcgttagacccaaagaatggtaggatcgtaggagatagggagaaagaagaaacagtttagatttgtgggatgaggtgaaatgtatcaagtccacagcatctccttttgcctgtggcagcagcacaggtgttgattgatgatgatgatgacatgtctaaattagtttttggttcttttttcccacccccagaaaatcttgacctcacctggcggctgccgcagtgtgtgccggagatggctgccatctttccctcctttgtaaagcttttctagctctgagctagtggtggttggtaccttagagaatgttcttttgttcctgcccttttttgcggggtaggaaggtattcctagtgtaaaatatggttggcatgttggatggtggtatttgtttggcctaatgcgactgattcaaccaattcttcggctcatgtcctatagatgtttgctaaccttgtaggccttgaaatc</dnaseqindica>

External Link(s)

NCBI Gene:Os08g0162100, RefSeq:Os08g0162100