Difference between revisions of "Os09g0114500"

From RiceWiki
Jump to: navigation, search
(References)
(Knowledge Extension)
Line 25: Line 25:
  
 
===Knowledge Extension===
 
===Knowledge Extension===
* [http://en.wikipedia.org/wiki/Gibberellins  Gibberellins (GAs)] are one of the most important endogenous growth regulators in plants<ref name="ref2" /><ref name="ref3" /><ref name="ref4" /><ref name="ref5" />. They are not only required for stem elongation but indeed participate in most stages of plant development<ref name="ref3" />. GAs mediate between certain environ-mental signals (e.g. light quality and photoperiod) and the inducedphysiological responses <ref name="ref3" />(e.g. stem extension and flowering). GA-deficient mutants are usually much shorter than the wild type, which indicates  the corresponding genes such as '''''sd1'''''[http://ricewiki.big.ac.cn/index.php/Os01g0883800 ('''''Os01g0883800''''')]<ref name="ref6" /> in rice may have a relationship with [http://en.wikipedia.org/wiki/The_Green_Revolution The Green revolution].
+
* [http://en.wikipedia.org/wiki/Gibberellins  Gibberellins (GAs)] are one of the most important endogenous growth regulators in plants<ref name="ref2" /><ref name="ref3" /><ref name="ref4" /><ref name="ref5" />. They are not only required for stem elongation but indeed participate in most stages of plant development<ref name="ref3" />. GAs mediate between certain environ-mental signals (e.g. light quality and photoperiod) and the inducedphysiological responses <ref name="ref3" />(e.g. stem extension and flowering). GA-deficient mutants are usually much shorter than the wild type, which indicates  the corresponding genes such as '''''sd1''''' ('''''[[Os01g0883800]]''''')<ref name="ref6" /> in rice may have a relationship with [http://en.wikipedia.org/wiki/The_Green_Revolution The Green revolution].
  
 
* The biosynthesis of GA in higher plants can be divided into three stages: (1) biosynthesis of ''ent''-kaurene in proplastids;(2) conversion of ''ent''-kaurene to GA12 via microsomal cytochrome P450 monooxygenases;(3) formation of C20- and C19-GAs in the cytoplasm<ref name="ref4" /><ref name="ref2" />. GA biosynthesis is catalyzed by three classes of enzymes: terpene cyclases catalyze the synthesis of ''ent''-kaurene from geranylgeranyl diphosphate; cytochrome P450 monooxygenases catalyze the steps of the pathway from ''ent''-kaurene to GA12; and soluble dioxygenases catalyze the final steps of the pathway<ref name="ref5" />.
 
* The biosynthesis of GA in higher plants can be divided into three stages: (1) biosynthesis of ''ent''-kaurene in proplastids;(2) conversion of ''ent''-kaurene to GA12 via microsomal cytochrome P450 monooxygenases;(3) formation of C20- and C19-GAs in the cytoplasm<ref name="ref4" /><ref name="ref2" />. GA biosynthesis is catalyzed by three classes of enzymes: terpene cyclases catalyze the synthesis of ''ent''-kaurene from geranylgeranyl diphosphate; cytochrome P450 monooxygenases catalyze the steps of the pathway from ''ent''-kaurene to GA12; and soluble dioxygenases catalyze the final steps of the pathway<ref name="ref5" />.
 +
 
==Labs working on this gene==
 
==Labs working on this gene==
 
* Research Center for Molecular and Developmental Biology, Key Laboratory of Photosynthesis and Environmental Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, Beijing 100093, China
 
* Research Center for Molecular and Developmental Biology, Key Laboratory of Photosynthesis and Environmental Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, Beijing 100093, China

Revision as of 09:31, 4 April 2013

The rice Os09g0114500 was reported as Brittle Culm 12(BC12) and gibberellin-deficient dwarf1 (gdd1) respectively in 2010 and 2011 by Chinese researchers[1][2].

Annotated Information

Figure 1. BC12 Mutant VS. WT(from reference) [2].

Function

BC12 plays an important role in cell-cycle progression, cellulose microfibril deposition and wall composition in the monocot plant rice[1]. This gene encodes a kinesin-like protein with transcription regulation activity, which can mediate cell elongation by regulating the expression of the KO2 gene in the GA biosynthesis pathway[2]. It is also likely to be a good subject for exploring the link between cell growth and cell wall formation in rice[1].

GO assignment(s): GO:0003777, GO:0005524, GO:0005875, GO:0007018

Mutation

  • Figure 1 shows the gross morphology of the wild type and mutant plants. The mutant was shorter than the wild type at the three-leaf and heading stages (Figures 1A and 1B). Also, mutant spikes and grains were slightly shorter than those of the wild type (Figure 1C). Nearly every internode of the mutant was shorter than that in the wild type[2].

  • The breaking force of bc12 mutation culms and leaves was reduced to approximately 25% of that in the wild-type. The cellulose content was not significantly altered, but the lignin content was increased by approximately 50% in mutation. The higher lignin content resulted from a general increase in all three monomers.[1].
Figure 2. Classification of the genes up- or downregulated fourfold or more in Mutation by whole-genome DNA microarray analysis[2]

Expression

  • Expression pattern of BC12
    Quantitative PCR revealed that BC12 is universally expressed in all organs examined, with higher expression in panicles and culms[1][2]. The RT-PCR analyses also shows greater expression of BC12 in the tissues enriched in dividing cells than in those enriched in non-dividing cells[1].

  • Expression Analysis in Mutant
    Affymetrix whole-genomemicroarray chip analyses by Juan Li et al. shows that 116 downregulated and 125 upregulated genes in the mutant compared with the wild type (more than four fold expression change; Figure 2). Of note, the genes involved in cell wall expansion were significantly altered in expression in the mutant.
    Those encoding xylanase inhibitor protein and cellulose synthase (CESA6) were greatly upregulated. By contrast, the gene for lignin forming anionic peroxidase was downregulated. That imply BC12 might be involved in the regulation of genes associated with cell wall assembly.Of note, the expression of the rice KO gene KO2, a key enzyme in early GA synthesis, was greatly decreased in mutation compared with the wild type[2].


Figure 3. Phylogenetic tree of BC12 and representative homologs from Arabidopsis and animals.(from reference) [1].

Localization

The production of BC12 was located at both the nucleus and cytoplasm and associated with microtubule arrays during cell division[1][2]. An NLS with 17 amino acid sequence was found in this gene[1].

Evolution

Phylogenetic analysis by Mu Zhang et al. revealed that BC12 and motor proteins selected from various kinesin subfamilies are divided into separated clades(Figure 3). Kinesin-4 proteins from several representative species were clustered together but formed different subclades. Among the kinesin-4 proteins, those from rice and Arabidopsis were found to belong to a monophyletic clade with 100% bootstrap support. BC12 showed the closest homology to FRA1, which has been reported to be involved in cellulose microfibril deposition[1].

Knowledge Extension

  • Gibberellins (GAs) are one of the most important endogenous growth regulators in plants[2][3][4][5]. They are not only required for stem elongation but indeed participate in most stages of plant development[3]. GAs mediate between certain environ-mental signals (e.g. light quality and photoperiod) and the inducedphysiological responses [3](e.g. stem extension and flowering). GA-deficient mutants are usually much shorter than the wild type, which indicates the corresponding genes such as sd1 (Os01g0883800)[6] in rice may have a relationship with The Green revolution.
  • The biosynthesis of GA in higher plants can be divided into three stages: (1) biosynthesis of ent-kaurene in proplastids;(2) conversion of ent-kaurene to GA12 via microsomal cytochrome P450 monooxygenases;(3) formation of C20- and C19-GAs in the cytoplasm[4][2]. GA biosynthesis is catalyzed by three classes of enzymes: terpene cyclases catalyze the synthesis of ent-kaurene from geranylgeranyl diphosphate; cytochrome P450 monooxygenases catalyze the steps of the pathway from ent-kaurene to GA12; and soluble dioxygenases catalyze the final steps of the pathway[5].

Labs working on this gene

  • Research Center for Molecular and Developmental Biology, Key Laboratory of Photosynthesis and Environmental Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, Beijing 100093, China
  • State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China
  • State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences, angzhou 310006, China
  • Key Laboratory of Analytical Chemistry for Biology and Medicine (Ministry of Education), Department of Chemistry, Wuhan University, Wuhan 430072, China
  • Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China
  • State Key Laboratory of Plant Physiology and Biochemistry, Department of Plant Sciences, College of Biological Sciences, China Agricultural University, Beijing 100094, China
  • National Center for Plant Gene Research, Beijing 100093, China

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9 Zhang M, Zhang B, Qian Q, et al. Brittle Culm 12, a dual‐targeting kinesin‐4 protein, controls cell‐cycle progression and wall properties in rice[J]. The Plant Journal, 2010, 63(2): 312-328.
  2. 2.0 2.1 2.2 2.3 2.4 2.5 2.6 2.7 2.8 2.9 Li J, Jiang J, Qian Q, et al. Mutation of rice BC12/GDD1, which encodes a kinesin-like protein that binds to a GA biosynthesis gene promoter, leads to dwarfism with impaired cell elongation[J]. The Plant Cell Online, 2011, 23(2): 628-640.
  3. 3.0 3.1 3.2 Hedden P, Phillips A L. Gibberellin metabolism: new insights revealed by the genes[J]. Trends in plant science, 2000, 5(12): 523-530.
  4. 4.0 4.1 Olszewski N, Sun T, Gubler F. Gibberellin signaling biosynthesis, catabolism, and response pathways[J]. The Plant Cell Online, 2002, 14(suppl 1): S61-S80.
  5. 5.0 5.1 Helliwell C A, Chandler P M, Poole A, et al. The CYP88A cytochrome P450, ent-kaurenoic acid oxidase, catalyzes three steps of the gibberellin biosynthesis pathway[J]. Proceedings of the National Academy of Sciences, 2001, 98(4): 2065-2070.
  6. Lina Ma, Zhang Zhang, Gang Wu (2012) Gene: "Os01g0883800" in RiceWiki, available at http://ricewiki.big.ac.cn/index.php?title=Os01g0883800&oldid=166658 (Last update: Aug 23, 2012).

Structured Information

Gene Name

Os09g0114500

Description

Similar to Kinesin-like protein (Fragment)

Version

NM_001069115.1 GI:115477969 GeneID:4346402

Length

9531 bp

Definition

Oryza sativa Japonica Group Os09g0114500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 9

Location

Chromosome 9:1104794..1114324

Sequence Coding Region

1105331..1105453,1106559..1106705,1107046..1107195,1107272..1107531,1107897..1108084
,1108187..1108311,1108485..1108521,1108802..1108893,1109023..1109133
,1109242..1109352,1109576..1109669,1109830..1109945,1110316..1110411
,1110510..1110617,1110698..1110814,1110910..1110990,1111205..1111276
,1111553..1111646,1111759..1111787,1111870..1111967,1112065..1112160
,1112399..1112620,1113002..1113158,1113472..1113627,1113703..1113930

Expression

GEO Profiles:Os09g0114500

Genome Context

<gbrowseImage1> name=NC_008402:1104794..1114324 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008402:1104794..1114324 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgacgatggagcacggcgaggattgctgcgtcaaggtggccgtccatgtccgcccgctcatcggcgacgagaagcttcagggctgtaaggactgcgtctccgtcgtctccggcaagccgcaggttcagatcgggagccattccttcaccttcgaccatgtgtacggcagctccggcacgccgtcggcggccatgttcgaggagtgcgtggcgccgctcgtcgacggcctcttccagggctacaacgccaccgtgctcgcatacggccagactgggtcagggaagacctacaccatggggacggcctgcaaggagggctcacacattgggattatcccgcgtgccatggccacgctgttcgacaagatcgacaagctcaagaaccaagtagagttccagctgcgcgtttcgtttattgagattctgaaagaagaggtgagggatttgcttgatcctgctactgctgctgttggcaaacttgagaatggaaatggacatgcaaccaagttgtcggttccaggtaaaccccctgttcagatccgggaggcgtcgaacggggtcataacgttagcaggatcgaccgaagtgcatgtcactacccagaaagaaatgacggcatgccttgagcaaggatctctgagtcgtgcaactggaagtaccaacatgaacaaccaatcaagtcgttcccatgccatcttcacaatcacattggagcagatgcgcaaagcagatcccatcatgactttagatggaatgcctattgaagagatgaatgaagactatctctgtgccaaactccacttagtagatcttgctggatcagaacgtgctaaaagaactggttctgatggccttcggtttaaggaaggtgttcatatcaacagaggacttcttgctcttggcaatgtcatcagtgctctcggtgatgagaaaaagaggaaagaaggcgctcatgttccttaccgggacagcaaactcactcgccttctgcaggactctctaggtggaaacagcaagactgtaatgatagcctgtattagtccagcagatatcaatgctgaagaaacactgaacactttgaaatatgctaaccgcgctcgtaacatccagaataagccaattgtaaatagaaatcctgttgctgatgagatgaaaaggatgcgccagcaaattgaatacttgcaagcagaactcgtttcagctcgaggaggagttgtcttagatgatgttcagggtctcagggaaaggatctcaatgcttgaacagaaaaatgaagacctttgcagggaactgtatgaccttcgcaaccatggttacactgatccttgtgaacctgaactgcaaaaaattggaactggttacactaaaggtgaagggctcaaaagaagcttgcaaagtacagaaccatttgatgtccccatgactgactcagtaagagcaggcagccctaaagatattgatgatgaagtggccaaagaatgggaacacacaatgctgcaggatagcatgggcaaagagttgaatgaattaaacagacaactggagcaaaaggagtctgagatgaaaatgtatggatctgacactgttgcacttaaacaacactttggaaagaaacttttggagcttgaagaagagaaaagagctgtacagcaagaaagggacagattgttagctgaagttgaaagtctaaatgctgatggacaaacacacaagttgcgagatgcccagctgcaaaaattaaaaacccttgaagcacagattctagacctcaagaaaaagcaggagaaccaagttcaacttctgaaggaaaagcaaaagagtgatgaagctgctaagaagttgcaggaagaaattcattctataaaggcacagaaggttcaactacaacataaaatcaaacaagaagcggaacaattccggcaatggaaggctacccgtgaaaaggaactcctgcagttgaggaaagaggggcggcgaaatgagtatgaacgccacaaacttcaagcacttaatcagcggcagaagttggttttgcagaggaagactgaagaagctgcgatggctaccaaaaggctgaaagagttactagaggctcggaaatcatcaggacgtgacaactcaggcatgaatggtacttctcctggctctcatatgactgagaaatcattgcaaaaatggctagagcaagatttggaagtcatggtgcatgttcatgaagttcgaaacgaatatgaaaagcaaagtcaattgcgtgctgcacttggtgaggagcttgccattttaaaacaagaagatgtcatgtctggtgcagctagtccgcccagagggaagaatggaaactctagggcaaatactttgtcaccaaatgcaagacaagctaggatagcatcacttgaaagcatggtgacaatatcttcaaatactctcgttgctatggcttctcaactctcagaagctgaagaaagagagcgtgcattctctgggcgtggtcggtggaatcagttgcgttcaatggcagaggcaaagagtttactgcagtatatatttaacgttgctgcagatgcaagatgccaagtaagggagaaagagatggagatcaaggaaatgaaggagcaaatgacagagcttgtgaccatccttcgacacagcgaatcacgtagaagggaaacggaaaagcagcttaagcaaagagagcaggcagctgtaactgccactacatctccaggaaacggaaatggttcagtgaagcactctgctgatgactccaacacaccattgtcaccagttgcggtgcctgcacagaagcagctgaagtactctgctggaattgtaaatagccccagcaaaggggttcctgcattcaacaaacaacatcttaagatggttcctatggcacagttgcctgttggcaagaaggtttcaatagcagggcaatcaggaaaactttggagatggaaaagaagccaccaccagtggctactgcagttcaagtggaagtggcaaaagccctggaaattgtccgagatgattcgacacagtgacgaaacgatgacaaggactcgacccagaccccagcttcttcctcatagacctcaaagagtgatgtga</cdnaseq>

Protein Sequence

<aaseq>MTMEHGEDCCVKVAVHVRPLIGDEKLQGCKDCVSVVSGKPQVQI GSHSFTFDHVYGSSGTPSAAMFEECVAPLVDGLFQGYNATVLAYGQTGSGKTYTMGTA CKEGSHIGIIPRAMATLFDKIDKLKNQVEFQLRVSFIEILKEEVRDLLDPATAAVGKL ENGNGHATKLSVPGKPPVQIREASNGVITLAGSTEVHVTTQKEMTACLEQGSLSRATG STNMNNQSSRSHAIFTITLEQMRKADPIMTLDGMPIEEMNEDYLCAKLHLVDLAGSER AKRTGSDGLRFKEGVHINRGLLALGNVISALGDEKKRKEGAHVPYRDSKLTRLLQDSL GGNSKTVMIACISPADINAEETLNTLKYANRARNIQNKPIVNRNPVADEMKRMRQQIE YLQAELVSARGGVVLDDVQGLRERISMLEQKNEDLCRELYDLRNHGYTDPCEPELQKI GTGYTKGEGLKRSLQSTEPFDVPMTDSVRAGSPKDIDDEVAKEWEHTMLQDSMGKELN ELNRQLEQKESEMKMYGSDTVALKQHFGKKLLELEEEKRAVQQERDRLLAEVESLNAD GQTHKLRDAQLQKLKTLEAQILDLKKKQENQVQLLKEKQKSDEAAKKLQEEIHSIKAQ KVQLQHKIKQEAEQFRQWKATREKELLQLRKEGRRNEYERHKLQALNQRQKLVLQRKT EEAAMATKRLKELLEARKSSGRDNSGMNGTSPGSHMTEKSLQKWLEQDLEVMVHVHEV RNEYEKQSQLRAALGEELAILKQEDVMSGAASPPRGKNGNSRANTLSPNARQARIASL ESMVTISSNTLVAMASQLSEAEERERAFSGRGRWNQLRSMAEAKSLLQYIFNVAADAR CQVREKEMEIKEMKEQMTELVTILRHSESRRRETEKQLKQREQAAVTATTSPGNGNGS VKHSADDSNTPLSPVAVPAQKQLKYSAGIVNSPSKGVPAFNKQHLKMVPMAQLPVGKK VSIAGQSGKLWRWKRSHHQWLLQFKWKWQKPWKLSEMIRHSDETMTRTRPRPQLLPHR PQRVM</aaseq>

Gene Sequence

<dnaseqindica>538..660#1766..1912#2253..2402#2479..2738#3104..3291#3394..3518#3692..3728#4009..4100#4230..4340#4449..4559#4783..4876#5037..5152#5523..5618#5717..5824#5905..6021#6117..6197#6412..6483#6760..6853#6966..6994#7077..7174#7272..7367#7606..7827#8209..8365#8679..8834#8910..9137#accccacctacacactcttcttcctcctcttccttcttcttcttcctcttcttctcctccatttccatttctccacccaccaccaaacatctccggatccttcgctccatcctcctcctaagaagagcccaagaagccagcaagatccaaagatcaagagcagcatttgtagctgcaactgctggtgctggtgctgttgctgttagatcgaggaggattcaacaagtgtgttggtggtggtggaagttgttacagaattgcgggtgagagaagtttcttcaccgcacctcaccaaaatctccatccatccgtctgaatcccaactccacctgcaactgcaactgcacggcgagattgcagtacaacccaagaaaccatgatgaagtggcagcatcagtagcagtagcagcagcaggaggaggaggaggaagagggctcctctttaatccttgcttcactcatcttcatcagaatcctccttattggctccgcctcgcattctgtgctgcatcggctgttgtatggtcggtggcgaagatgacgatggagcacggcgaggattgctgcgtcaaggtggccgtccatgtccgcccgctcatcggcgacgagaagcttcagggctgtaaggactgcgtctccgtcgtctccggcaagccgcaggtattccttctcttctctttttatcactcactcatttggcttcttttttcttgtttatacgtcccaattcagagagactagattgactctcatcctgtcaattgtttctggatttctcttttattttattttttttgggggggacgtgatttcctgggaaaatccaaacaatatgataagttctctgcattgttcttttaagattacctgaaatttttaattaaattcagagattggagacatattttgtccaagtcaagaaagaaaaatctctgactctgtttttctctgttgagtacaagaacagaggagctcagaagaggacttgttgtttcccccaattttggtcctctaattcagaaaaaaaaacttgtcaaaattcatggagaatctagcttgcttccttgttttagctccctatgaaatgatagagatgcccatctgttcgctttccctttctcttagttttgttttcttttccttttgatcatcattaaatgaggctctagagtcttccttctccttttttcttcttcagaataaaattgtatatatttttttcactgtcggcagcgccaaatgttcctcattttttggtgtgaagttgcgtccaatgttgatgacgctaatgctataccctttcttttatctggggctggaattctgtcagcatcacgcaattatcacccaggttttctttctccagttttgtccatccaacactcatccttgttggattcttcccttcccttccttttctttcttccatcaagatttattaagtcattttctcagacaaaacgcagcaagattaattaggttccttaattaatctaatcctccattacacaaactcgaatgatgagatctggcttaggtatcatattcttttggtaagatggtttgctctccataagactgttgtttgttgatctttcttgggttccccaccaatttcatttctttgggagatgatgaaaagttactttctttcattctcccaaatcaatctttttaccggtggtggcggtggtgatgatgggggtgaaaaaaaagggcatatctttctttgttttgttgttgctgatgggttttgttgttgcaggttcagatcgggagccattccttcaccttcgaccatgtgtacggcagctccggcacgccgtcggcggccatgttcgaggagtgcgtggcgccgctcgtcgacggcctcttccagggctacaacgccaccgtgctcgcatacggccaggtccgccattgccattgccatccaatcatatgcttccatctccatccccatgtgccaccatggaccaccatgttggggaagatgcaaaagccagcaccacatcatgtgctcctgctcctgctcctcctgctgctgcctgctaatccccttttcttttcttttccttttcttttcacacttgcttattagttgcttttcttctccagctgtttctgcctcatgatgctagatcattttcttgttttttcacatcctctgtgaacaaaaaaaggaaaagaagagaagagattggaaaaatgctgattgatttggtggttgtttcatctcttcctttttacagactgggtcagggaagacctacaccatggggacggcctgcaaggagggctcacacattgggattatcccgcgtgccatggccacgctgttcgacaagatcgacaagctcaagaaccaagtagagttccagctgcgcgtttcgtttattgaggtaaattacctgttcctggatgaatcaaacatttgtgggattgtagagaatccaattgtgctcgttctcttgatagattctgaaagaagaggtgagggatttgcttgatcctgctactgctgctgttggcaaacttgagaatggaaatggacatgcaaccaagttgtcggttccaggtaaaccccctgttcagatccgggaggcgtcgaacggggtcataacgttagcaggatcgaccgaagtgcatgtcactacccagaaagaaatgacggcatgccttgagcaaggatctctgagtcgtgcaactggaagtaccaacatgaacaaccaatcaaggttagcaaacattatcctaatcattcgtcctttaccttttttagaggaggaagcaggtccattgatcaaccataattgatgacaagaaactagcatcattatggtcagaaactggcaatctttgcaggatacagctgtttgtgatgatttcttgcttctatgtttagtgtaggacctttttgcaggattagtcaatgtattgtcctaccctcaaaagagaaaccaattatttgtctagtttcaagtaattaattctctgctcaagtgctttaggacacattcaatcagattggttacctgatattccgttactaaattctacaaactttaatgaactttatgcttttggtttcggcatgtaatagtcgttcccatgccatcttcacaatcacattggagcagatgcgcaaagcagatcccatcatgactttagatggaatgcctattgaagagatgaatgaagactatctctgtgccaaactccacttagtagatcttgctggatcagaacgtgctaaaagaactggttctgatggccttcggtttaaggaaggtacttggcatgttgcttgttctatctgaatccctaatcaaacatccatcttgtcttgaaacaagatactccgtataatttatttatgtatcatgtcatcaggtgttcatatcaacagaggacttcttgctcttggcaatgtcatcagtgctctcggtgatgagaaaaagaggaaagaaggcgctcatgttccttaccgggacagcaaactcactcgccttctgcaggtattattcttctgacccaagtgcacaggcctttgtacagaagcattgaattcatagctctgttcaagaagtagggccagctcacatttaagcatatataatacttgaatctttgcatttagtttctttcattttactaactaatctgttttatatctattttattattataggactctctaggtggaaacagcaagactgtaatgataggtaattcatttggttggagattgtttaatcatatttttatatgatttaggattttttctaaataatgcttgtcaaagttccagaattggggtttaaaataaaaaaaaataaaacgatgatctattcattttatcttcggtaaaaaaaaatgcatcttgtcatatgatttaatttgttttcataaataagaaaactcggatgtaccttgattttcactaactgttttggttgatattactattacatgcaactgacatggatctatatttttctcctgcagcctgtattagtccagcagatatcaatgctgaagaaacactgaacactttgaaatatgctaaccgcgctcgtaacatccagaataagccaattgtaagttcattaaaatggtctcgtcagaaaagtatctgacatttatctgcgttatgtttctttaattaattggtttggttccgtcaaggtgattatttgacatccctatatttactttcctattttcaggtaaatagaaatcctgttgctgatgagatgaaaaggatgcgccagcaaattgaatacttgcaagcagaactcgtttcagctcgaggaggagttgtcttagatgatgttcaggtaaattcttttctcgtctatcctcagtgtccttgaccatcttgttctataaggcacactcactcacaataacagtatgagtataataacaagtggttccattttcagggtctcagggaaaggatctcaatgcttgaacagaaaaatgaagacctttgcagggaactgtatgaccttcgcaaccatggttacactgatccttgtgaacctgaactgcaagtatgttgatgagttcttctgcaagctttcggagattttacatttgaaaacaagcatacaatttactcttctacggcttctttcatgatagattcccttttctctcaaaggaaataaaagaggggacataacatgacattgtctactatggattgttttcatgcaattgcgcttgaaatggtatatgataaaccatgcatataactatttttatctctttcagaaaattggaactggttacactaaaggtgaagggctcaaaagaagcttgcaaagtacagaaccatttgatgtccccatgactgactcagtaagaggtaatctattagcaccttcattatttcatctcgttggcattcagaaattttattcagtcccatcttaagccatgactaagcagtgaacatggtggactactattttcattttatttttccttgataatttccttattctgcgataattctggacctccagcaggcagccctaaagatattgatgatgaagtggccaaagaatgggaacacacaatgctgcaggatagcatgggcaaagagttgaatgaattaaacagacaactggagcaaaaggaggtaatacagaaaacgtttaaataaatcaatgtgttttaatcttctaggggtgattaaacaaatacacgagctaatgttcgttcctggatgatatatgattgtacatatctcaatcaagcttcttgtgcaacttcatttttctggatactcaattcatctccatatgttgtatcatggtgacagttaaacgtgttgtcaaagaagttacaaggatcattggttgtaccatttttaatttcaatatgatggaagtgtggatatgaacattatttttaatggttcactgaatgtacatgcagtgacatgctactcttgttaatctgctcatgcttgccaagacctaccttaaattttctcaatttctttgcagtctgagatgaaaatgtatggatctgacactgttgcacttaaacaacactttggaaagaaacttttggagcttgaagaagagaaaagagctgtacaggtttgttttaaaaaaaaatcttcccattagcatattcactcatccaacagttgtgttttcctaacctttgctaacgagaaagttctgaacaatttcagcaagaaagggacagattgttagctgaagttgaaagtctaaatgctgatggacaaacacacaagttgcgagatgcccagctgcaaaaattaaaaacccttgaagcacaggtgaataaacctttataatttgtttgaatgcagttcgtgttgttcagtacatgttggtcatacaagacttggacctgcagattctagacctcaagaaaaagcaggagaaccaagttcaacttctgaaggaaaagcaaaagagtgatgaagctgctaagaagttgcaggaagaaattcattctataaaggcacagaaggttgtcttccctttctcatcatgtcaagttctaatgcatcacattttacactatcgtaagtcataacaattttgccaaccttgttccattatcaggttcaactacaacataaaatcaaacaagaagcggaacaattccggcaatggaaggctacccgtgaaaaggaactcctgcaggtatgaataatttaatatgcagttaaagcaaataactgcaaaattgctatgtcattaaattaaattcatatagaacaaggaacgggtaaaaatgatgtgaccgtatctacttagagattcatctctaacccctttttatgtaatgtttctgttgtactatttttgtggtaagcattatgagaagtaaacctcacttactgtttcctgaatgcagttgaggaaagaggggcggcgaaatgagtatgaacgccacaaacttcaagcacttaatcagcggcagaagttggtaagcttcttatgtagaattgtatttcaaagaaaagaaagtgtcaatgtgaaagtttggaaaaattataagtttattgtaggcattatccaaactatcattatttggactatcttaaaatactaagcttcactttatgtgtaactagctgccctgacatagttttcgtcaaagttcatatcttacttagctatataattacgtgtaagtttttccctcatattatcatgtctatttataaaatattaaatatcaaagttttgcatctttatgcaggttttgcagaggaagactgaagaagctgcgatggctaccaaaaggctgaaagagttactagaggctcggaaatcatcaggacgtgacaactcaggtatctctctccgcattgcgaccatttttcgcattataattaatactcccaatctaacagctcttccttctttttctttttttttttttttgctttcttccaaacacatcaggcatgaatggtacttctcctggctctcatgtaagttattttccatacttaaagaaaaagatcagttgcttatttggaaatatccttgagaatacttttttttgtaatgcagatgactgagaaatcattgcaaaaatggctagagcaagatttggaagtcatggtgcatgttcatgaagttcgaaacgaatatgaaaagcaaagtcaattgtatgtgattcattttatttccttcccaaatgtaaattatagagatcattcctcatgtaatgcatgattatgatgactaatttaaatggttttaaaggcgtgctgcacttggtgaggagcttgccattttaaaacaagaagatgtcatgtctggtgcagctagtccgcccagagggaagaatggaaactctaggtaactgttatccccatagttctattttgtagttcaggtacctttaagctggacagtatctttaatccatatattatcacaaactgtttaagaaatataagagcaccgtttaatatgtccttgtctgtaatctggttgttatatttgggtccgtattttatatttctcatattttctcaaaatgtgcaatcagcacatccaaatatttatgcttgtattgctgcattttgtttctcagggcaaatactttgtcaccaaatgcaagacaagctaggatagcatcacttgaaagcatggtgacaatatcttcaaatactctcgttgctatggcttctcaactctcagaagctgaagaaagagagcgtgcattctctgggcgtggtcggtggaatcagttgcgttcaatggcagaggcaaagagtttactgcagtatatatttaacgttgctgcagatgcaaggttggtatttattcttttggcttcattatttaatagtatggtagcatccatccttgtaggacttctcaatttgcagaacctggaaacaaattatttttactaaagagctaaaaatctcactttttctttctaaatagttgaaaatctgtaagtgttattttgctaagaatatggcactgattcgaataaaagagtgtggtactgatttgaaaataggaataacaaaaaaaaaattctgaactcaaagggcaactttatttcttcctgaaagcatgacaacaatgtgaatggaagaacaatgcaaagccgtttttatgatactctgtaaaaatgatcatttgtacaaaagtatggaactaaccttcactgttgaaatatcagatgccaagtaagggagaaagagatggagatcaaggaaatgaaggagcaaatgacagagcttgtgaccatccttcgacacagcgaatcacgtagaagggaaacggaaaagcagcttaagcaaagagagcaggcagctgtaactgccactacatctccagtatggtttctatgagctcacagcaattacccctcagtagaaaaaaatgttgaatgatgaaaggattacctaaacatctaaaacaaatatctggtggtgaggagggtatttaacatctccattacccatgttcaaattctctcgtacgccctgcttgaaagggcgaaaagaagaaaacatatcatagggtatagtagatggaactgacaaaaaaacattgagtcacttgaatccctaactgatagtcacaagagtacaagatattcaacaaatatcgtgatagttcttaatggaaattttatgcatcttacagggaaacggaaatggttcagtgaagcactctgctgatgactccaacacaccattgtcaccagttgcggtgcctgcacagaagcagctgaagtactctgctggaattgtaaatagccccagcaaaggggttcctgcattcaacaaacaacatcttaaggtatctctacccccctgaaatactctttgttctatctccctctctcgtatttaaaattggtgacgtacaatgcagatggttcctatggcacagttgcctgttggcaagaaggtttcaatagcagggcaatcaggaaaactttggagatggaaaagaagccaccaccagtggctactgcagttcaagtggaagtggcaaaagccctggaaattgtccgagatgattcgacacagtgacgaaacgatgacaaggactcgacccagaccccagcttcttcctcatagacctcaaagagtgatgtgaaaaaggcttttcttttcttttttttcttcgtctccacatggactgacacggtttacacagctaactacctccacaagggtaacaatgcagctaaaagctccaggagatctccttcgtgcttcgattttacttagccacgggatcgaaaaaaaaaaagtatatgttcatagggtgactgtctttggatgtaaatttcttgtgcctatatagtgagtgtgaatgttagagatgaaaatttagcgagtgagcgagggagggagtggccgttcttcgcgaaagcactgactgagcacaatgcttcatgtttcagcactcatcaactggtgagatgtcatacttgttgtccttctgcatataaggaaaaatctgtcgaaggatggcgtcttgtaaagtc</dnaseqindica>

External Link(s)

NCBI Gene:Os09g0114500, RefSeq:Os09g0114500