Difference between revisions of "Os02g0682200"

From RiceWiki
Jump to: navigation, search
(Function)
(Annotated Information)
Line 7: Line 7:
 
'''GO assignment(s):''' GO:0003700, GO:0005634, GO:0043565
 
'''GO assignment(s):''' GO:0003700, GO:0005634, GO:0043565
  
===Expression===
+
===Wild Type VS. Mutant===
Please input expression information here.
+
 
 +
* In the research reported by ''Dabing Zhang'' et al. in 2010, a ''osmads6'' mutant line with flower morphological defects was isolated from ''Japonica'' subspecies 9522 background treated with 60-Co γ-ray (280 Gy)<ref name="ref2" />. No significant differences were observed when comparing the vegetative development stages, flowering time or inflorescene morphology of Wild type and the ''osmads6'' mutant (Figure 1A and 1B). <br>
 +
 
 +
* However, when comparing the morphology of flower organs, a defection of floral development could be found in ''osmads6'' mutant. The spikelets of ''osmads6-1'' at stage In9 showed somewhat larger palea than wild type (Figure 1C and 1D). The wellinterlocked lemma/palea structure was destroyed in the ''osmads6-1'' mutant flower because of the altered marginal tissue (Figure 1F). Ectopic indeterminate glume-like structures enclosed the stamen filament in ''osmads6-1'' mutant flowers (Figure 1G).<br><br>
 +
 
 +
[[File:OsMADS6_2_Mutation.jpg|center|thumb|680px|'''Figure 2.''' ''mfo1-1 mutant VS. WT (from reference<ref name="ref1" />).'']]
 +
 
 +
* In the research reproted by ''Shinnosuke Ohmori'' et al. in 2009, another ''MADS6'' mutant ''mfo1-1'' was described<ref name="ref1" />. There is also no obvious abnormalities between ''mfo1-1'' and wild type in the vegetative stage, however, abnormal flower morphological was observed in ''mfo1-1''. A slightly enlarged palea and were half open was found in the florets of ''mfo1-1'' (Figure 2A and 2B). <br>
 +
 
 +
* Compared with wild type, ''Mfo1-1'' is in defect of interlocking between the lemma and palea (Figure 2C and 2D). The ''mfo1-1'' palea also lacked the membranous marginal region of palea which is found in wild type and its surface is relatively rougher then that of the wild-type lemma (Figures 2E and 2F).
 +
 
  
 
===Evolution===
 
===Evolution===

Revision as of 03:02, 6 August 2013

The rice Os02g0682200 has been reported as MADS6 or MFO1 more than four times since the year 2009. As a member of MADS-box gene family, MADS6 draws attention of plant molecular biologists for its special functions in the regulation of rice flowers development[1][2][3][4][5].

Annotated Information

Figure 1. osmads6 mutant VS. WT( from reference [2]).

Function

OsMADS6, the AGL6-like gene in rice, plays an essential role in specifying floral organ, meristem identities and endosperm nutrient accumulation in rice[1][2][3]. It is also an important epigenetic regulator in rice[3]. The study by Shinnosuke Ohmori et al. in 2009 showed that the loss of OsMADS6 function in rice resulted in aberrant floral morphology[1]. The study by Dabing Zhanga et al. in 2011 further explained how OsMADS6 worked with MADS3, MADS16, MADS13 and MADS58 et al. and showed that MADS6 is a key player in specifying flower development via interacting with other floral homeotic genes in rice[4].

GO assignment(s): GO:0003700, GO:0005634, GO:0043565

Wild Type VS. Mutant

  • In the research reported by Dabing Zhang et al. in 2010, a osmads6 mutant line with flower morphological defects was isolated from Japonica subspecies 9522 background treated with 60-Co γ-ray (280 Gy)[2]. No significant differences were observed when comparing the vegetative development stages, flowering time or inflorescene morphology of Wild type and the osmads6 mutant (Figure 1A and 1B).
  • However, when comparing the morphology of flower organs, a defection of floral development could be found in osmads6 mutant. The spikelets of osmads6-1 at stage In9 showed somewhat larger palea than wild type (Figure 1C and 1D). The wellinterlocked lemma/palea structure was destroyed in the osmads6-1 mutant flower because of the altered marginal tissue (Figure 1F). Ectopic indeterminate glume-like structures enclosed the stamen filament in osmads6-1 mutant flowers (Figure 1G).

Figure 2. mfo1-1 mutant VS. WT (from reference[1]).
  • In the research reproted by Shinnosuke Ohmori et al. in 2009, another MADS6 mutant mfo1-1 was described[1]. There is also no obvious abnormalities between mfo1-1 and wild type in the vegetative stage, however, abnormal flower morphological was observed in mfo1-1. A slightly enlarged palea and were half open was found in the florets of mfo1-1 (Figure 2A and 2B).
  • Compared with wild type, Mfo1-1 is in defect of interlocking between the lemma and palea (Figure 2C and 2D). The mfo1-1 palea also lacked the membranous marginal region of palea which is found in wild type and its surface is relatively rougher then that of the wild-type lemma (Figures 2E and 2F).


Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os02g0682200

Description

Similar to MADS box protein

Version

NM_001054284.1 GI:115447938 GeneID:4330328

Length

7968 bp

Definition

Oryza sativa Japonica Group Os02g0682200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:28762840..28770807

Sequence Coding Region

28762972..28763153,28765912..28765990,28767927..28767988,28768220..28768319,28769648..28769689
,28769999..28770040,28770138..28770283,28770460..28770559

Expression

GEO Profiles:Os02g0682200

Genome Context

<gbrowseImage1> name=NC_008395:28762840..28770807 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:28762840..28770807 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggggaggggaagagttgagctgaagcgcatcgagaacaagatcaacaggcaggtcaccttctccaagcgccgcaacggcctcctcaagaaggcctacgagctgtccgttctctgcgacgccgaggtcgcgctcatcatcttctccagccgcggcaagctctacgagttcggcagcgccggcataacaaagactttagaaaggtaccaacattgttgctacaatgctcaagattccaacaatgcactttctgaaacccagagttggtaccatgaaatgtcaaagttgaaagcaaaatttgaagctttgcagcgcactcaaaggcacttgcttggggaggatcttggaccactcagcgtcaaagaattgcagcagctggagaaacagcttgaatgtgcactatcacaggcgagacagagaaagacgcaactgatgatggaacaagtggaggaacttcgcagaaaggagcgtcagctgggtgaaattaataggcaactcaagcacaagctcgaggttgaaggttccaccagcaactacagagccatgcagcaagcctcctgggctcagggcgccgtggtggagaatggcgccgcatacgtgcagccgccgccacactccgcggccatggactctgaacccaccttgcaaattgggtatcctcatcaatttgtgcctgctgaagcaaacactattcagaggagcactgcccctgcaggtgcagagaacaacttcatgctgggatgggttctttga</cdnaseq>

Protein Sequence

<aaseq>MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVA LIIFSSRGKLYEFGSAGITKTLERYQHCCYNAQDSNNALSETQSWYHEMSKLKAKFEA LQRTQRHLLGEDLGPLSVKELQQLEKQLECALSQARQRKTQLMMEQVEELRRKERQLG EINRQLKHKLEVEGSTSNYRAMQQASWAQGAVVENGAAYVQPPPHSAAMDSEPTLQIG YPHQFVPAEANTIQRSTAPAGAENNFMLGWVL</aaseq>

Gene Sequence

<dnaseqindica>133..314#3073..3151#5088..5149#5381..5480#6809..6850#7160..7201#7299..7444#7621..7720#atattctcgtcatcattggaggctttagcaagcaagaagagaggcagtggtggtggtggtggaggaggagctagctagcctgtgcttgctgatcggtgctgagctgaggaatcgttcgatcgatcgggcgagatggggaggggaagagttgagctgaagcgcatcgagaacaagatcaacaggcaggtcaccttctccaagcgccgcaacggcctcctcaagaaggcctacgagctgtccgttctctgcgacgccgaggtcgcgctcatcatcttctccagccgcggcaagctctacgagttcggcagcgccgggtataattaatacagacacaacaacacacacaaccaacaaaccagcatcaatttgaacctgcagatctgctgttttctctgatcaattgcttctttttttttgttcttttttgtttcttttatctgctgcaacggcgtcctgctcctctggggtttctcgttttctttttcatttatttttagcaggtgccaagtagccgagctactatacttacctggccatgttaattattttattccgtctgtctgtgtgtgtctgtgcatactactatagggacatggcgcggtgttcttataaaccgggaggccggatccctaactagcatgggaggatatcttttcagcggatctatacaaaccctactcctgctgacctctttcttccagtttctccgggtcttccttggattattattgcccatcttccgggttgtgcgtgtgtcagagacagctcgaacgataaatttctcaaaaccagtactagagagggtgtgttgtgtgtgagaactgagtggagagttagcatgaaggctgcaaactagaaaggaaggtatgttctttcctttttgatccatcaggggagccccttctggtattaagatctttccggcacattgattttcatactttgtgatgaccctggaagaatcggcgtagcagcgtagcaccgctccattttggtcttaccctcacctccccatgctatgaactgatcaatttcattgttcttcatcacccttctcctagctttccacttccttcggatctcatgccatgtttctcagcatgaatcaaatttaattcgtgttttctacttccatatatactggaagaaatttaattagatctatttttgctcgggaggtcttcatactttgagttctgatgccatcaccttatttcccccccccccttctcttgttctatcttcttcctcatcttggcttgatcattttgatctgtcagttatagcatgatgcattctcaatttgactgtatgtaagttcaaccggaaatatgttgaatggattttctatatatcaacacttgatgtcaggcctgcatctgtttcgcttgtggtggtgtggccaaaattgtctatatttgatctttgctcttctttctcctcatttcatgacgattcctactacggcttaaaccattctttattctttactaatcatggatgttgcttgactcctagttgtttcgtactagctcaacttggagatcttttcattatttgcctagttggtgggtacgtttgtgacagatctaaaatggtgcacgaaaagttttacttattatgaaaaaagggagcttaacagggtaatttctctatttattcgtgatgacattttttccttgataagggggattttttataatctgcactcacatgtttatatgtaaaatctagctcttttgttttgtttttggcatatttcccgctaagtatagagtttatgtggataacattataacttttcaagatccaatccacatctttgattgtgaaaatcatacaatagggaaaatcaactgaagggttaattagatgctatatgcatatatatatatatgtgcgcgcgcgcgcgcctgaatttaactatgtatgcatccaactgtttcattgaaaaagatttgatatttttcagtctattctttttcgagtatatatttaatatgtttcaatctgttttgaccattataagataaagcctatattcaccaggcatttgagatgatcttttcatgcatgaaaaagctgttgttatcacttcaactaaccagacgatctaacatgtatttgtataagaaacagaccttgatttccttctgtaaaatcatgcatgtgttcgttttgaattggagtcggcgcgcctgtgttttgaccgtcaggaaagtcttttttttccctgaatagtcaagggtctatacttcttgaagcaattgggacactaatcaattattgtttatacctcggaccatcttttccttcttcacaccactaatcagtttatgccttggaccattaattgtgttgttcacaagcttcttgtttatggtttacaaagcattcgcctagatttgtgtgtgtctctacacatcgatcacttttaaatacttgtcgctttcagttattcttttaacgtttggttatttatcttatttaaaaaaattatcgtattattatttattttgtttgtgatttactttattatcaaaagtatttcaaatatgacttatctttttttataagtgcactaatttttcaaataagatgaatggtcaaatgttacaagaaaaagttaaagcaaccactaatttagggcggaggtagtaaaacctagttattgtaaccaataattttatcaatctataaatgcaacacaaagtcacttcgtgatatctcacacaaagccacttcaacgatgaaagctgactgcatgttttatcaaaacacatgtgatcagtttgttggatgaaaaaaattatctatgtcataaatcaagagttataatataagcttctggctctacaagtaacatttctatgttttttttttacgttcttacatactatgttttgccaaaaaaaacatgatcattttgttggacgaaaagaaatagtaaatatagagtgacctttgatatcattataatataagcttctgcctctataaataacatctatgcactttttacgtcgtagtaatttgatatatgagaaatttacatataacatttttgtgcagcataacaaagactttagaaaggtaccaacattgttgctacaatgctcaagattccaacaatgcactttctgaaacccaggtatatatatctgcatgaactggtcatgaatttctgctgttggttttggtttcaaaatgggtcttgtttttttactatatatatttttgtatgaatatgcaattatcaatgtcctgacattgaaattagctacagtataaacctagctaggtattttcatcgtattgtgagattacattcaataaaaagtacacagattagcataactgtgttaatttgatgatgtatcccaaagctaatttgcagtgacttaaaatattttacttgacacagctactaaatcggatgttcttttcgtaaaagcattctaaagaatggcaaagtttagaagaattaaactagtagaatttcaacaccggcatgcattaaccatattttatgtaataaatgaagtttttattgacatgtcaaaggaggacaacaaagacaatcccttcttcctatatagttggtacccactacaagcattaacactataaagaagcatccaggttaagccacatcatcgataatcaatagccgtcggatcaaatgcatctttgtttgtttaactgtgcatgccttaagtaaggaaactgccatgggtaattaggcacatcaatggatgacccacttaagtgctcctggtcatgcattacatgcatcccccatattaagccactgctatatcccttaaccatctaccactcaaatgccaactttacactttattattttagaatgtttacttttgatatttcaattcttcaattctgtttgtaagcacatatttacaaagttgtttatcatcaccataaaatcccgtagcaacgcgcggggtatcaaactagttgtttgttataattataccatattacaatgcaagatcgtgctgtttacggcgtatatgtattcagaaatgttgcacctagtataggtttttaccagcatagaatatacaaatagctagtctaaatgactttttgtgcccctagctccctagtgtaaccttacatgaagtattccctgcatcgaatatgaagtatatattccctgcatcgacgaatatacaaatatactcctagctaggctaaaatacagccaccagtatgaagtaaattagtcgatgtagttcaatatttaaatatagatggtgattgaatgtacaacaatagtgcacatcccaaaaaaataagggtgtacctctgtgaccagatagtactccctcagtcagggtacgtccagattcattggactaggatatgtcacatccagtactagggccctgtttagattccaatttttttttcaaacttttaacttttccgtcacatcgaactttcctacatacaaacttccaacttttccgtcacatcgttccaatatcttcaaacttccaattttggcgtggaactaaacacagcctaggttggtttttcgtgggacggagggagtactctttatggtgattctaaatttcagtcaatcaattagagtacgtcctcataacatttcaaacaaaaacatagatgcccttgtgcataatttcaaaagtcatgagatcaaattgaaattcttgagaacttaccaaccgcaaaatatctaaggagttatgtcacttggttatatttatatcattgacatcctgcaacttatttgcccaataatcagtatatatagtttgctagctgtatcattaatagcatgtttcacaaaattttaaaaaaagaataagcccaacgtatatgtacaaggaggccatgtgacatatttagttaaaattcacaaacgacttttatcaagtgtttaaagaaaccgcagaaagttaatttgctctgtgtaacactaatattcagtgtatgattcgccaaacacacagttccttagtcgttagaactagctgataaatatttttgtgaactgaactaatggtttttcttttcctctgatcctgaagagttggtaccatgaaatgtcaaagttgaaagcaaaatttgaagctttgcagcgcactcaaaggtatttcactatgatctctccaagaagcataactcctgcaaatacacaatatatttttctataacatgcatgcaagtgataatgttgtgttaagggaaagagggaagaagcagcccataacgtgcatttacacacattattctgtaatatagctgctgcgaaactttatgtgtcatgcaatttaccttaatatttacattatgctctttgggttttgcttgattcttaaaggcacttgcttggggaggatcttggaccactcagcgtcaaagaattgcagcagctggagaaacagcttgaatgtgcactatcacaggcgagacagagaaaggtttatggcattctgcagtcctttgtttggaaccaaaatacttctgtttctagcctaccctggttcgcttgttatttgtccactgatttggatataggtgcaatacgtgagaagcaataaaatatacagtatgtctttagtttgtaggtaaagttatatatatttataaatagacaggaggtgtacgctagctatggaatatccccttgctaaagtttatataaagagcacctaactaatttgtttttgttcatggaagtgaacataataactgggaatgcttatcctacattatctaaagagaattgcataaaattgtttcaatctctagctaatgcatggtggtggtttggtagaaagccaagacatatttcacttagaatattgataccttattttatggtaaaggtcaactgatgatatttttaaagaagtgtgaaagctactatgcagcataagtaatccctttgtttcataaatttgccctaagtcattatctttaaccatcaatttctggaaatttgtgtagtttaacaaaatgtgaactgtacattctgtaaggatttttcatgttgtgtatctaacaacataacccttgtggtgttaaactatagtatcatttttttagaaactaatggtcaaaaatatatataagtgtttgaattaggacaaacgtagaatgacaagtaatttgaagcaactgggcgtagcatgtatcttgataaattcaccctattctaggcacgaaggtgatgcatacagtggcactaaatttcatataaaagactatctaagtatagaatagaaatatagaatggctagcacgcatgccctttttctttatatggatacatgtgtagtgacagggccgagcaactgcaacattaatctaaactgtcaatttcagatatactactacttatggctgcttgtttaggctaattaataattatatgtttactcttttcaaaataaaacacttcaaagctgcatgacaatcccgtcaacaaggatagtaatgacaatgagtagctgatgaaataatatggcttcaattctggagtttcaggaaaatttagctgctaaaaaaagaataagtgaataacccaaagaaaatagaactttgaaggatagaggtagagagattaaatatacactagtattcattttgtggtgcgtcgtacatgcttcaaaatctcccaaggaccataaaagatcccaagaaatagctaggtagaacacatgaaagttcagaaactggatataatctacacttcattatattactgtcaactcaatatgactgtgcttgaatggtttttgtgcagacgcaactgatgatggaacaagtggaggaacttcgcagaaaggtacattatcaatccaaagtttctcaagcatacatacagtatcagcattgccatgggcgggtgacttcaggagtgctagctactagtgataatctaaattaaaccacgaaatgacttggctagctttgacaatgcatctatattgccagcaaggctgctagggtataccgcatgcaagttaattagggtagatcgtgtagcctttgactgtataactaaagaaatggtagcttcgttcttgcgagagatttctttcatgagagttgttacatattatactatctccaatatatttttcttgtgccacaggagcgtcagctgggtgaaattaataggcaactcaagcacaaggttcttattcactcggaaatctgttatgccaatgcggtgcacatataattatttattgataattttcattcatatattctcatatccaatgctgcagctcgaggttgaaggttccaccagcaactacagagccatgcagcaagcctcctgggctcagggcgccgtggtggagaatggcgccgcatacgtgcagccgccgccacactccgcggccatggactctgaacccaccttgcaaattgggtaagattaatcaagaaaagccaagaccagaaatgcatatacttataacttctagctcaaatgcatacagctcgatcacagcatccgaactagtagaactaatgaaagattctcatcaaactgactgtgtatatcttgcttccattatattatctgaaaaacgattatgttactaggtatcctcatcaatttgtgcctgctgaagcaaacactattcagaggagcactgcccctgcaggtgcagagaacaacttcatgctgggatgggttctttgagctaagcagccatcgatcagctgtcagaagttggagctaataataaaagggatgtggagtgggctacatgtatctcggatctctctgcgagccacctaatggtcttgcgtggccctttaatctgtatgtttttgtgtgtaagctactgctagctgtttgcaccttctgcgtccgtggttgtgtttccgtgctacctttttatgttttgatttggatcttgtttgaaaataatcttaccagctttgggt</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0682200, RefSeq:Os02g0682200

  1. 1.0 1.1 1.2 1.3 1.4 Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. 2.0 2.1 2.2 2.3 Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. 3.0 3.1 3.2 Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. 4.0 4.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref4
  5. Cite error: Invalid <ref> tag; no text was provided for refs named ref5