Difference between revisions of "Os02g0682200"

From RiceWiki
Jump to: navigation, search
Line 36: Line 36:
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
<ref name="ref1">
 +
Ohmori S, Kimizu M, Sugita M, et al. MOSAIC FLORAL ORGANS1, an AGL6-like MADS box gene, regulates floral organ identity and meristem fate in rice[J]. The Plant Cell Online, 2009, 21(10): 3008-3025. </ref>
 +
<ref name="ref2">Li H, Liang W, Jia R, et al. The AGL6-like gene OsMADS6 regulates floral organ and meristem identities in rice[J]. Cell research, 2009, 20(3): 299-313.</ref>
 +
<ref name="ref3">
 +
Zhang J, Nallamilli B R, Mujahid H, et al. OsMADS6 plays an essential role in endosperm nutrient accumulation and is subject to epigenetic regulation in rice (Oryza sativa)[J]. The Plant Journal, 2010, 64(4): 604-617. </ref>
 +
<ref name="ref4">
 +
Li H, Liang W, Hu Y, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate[J]. The Plant Cell Online, 2011, 23(7): 2536-2552. </ref>
 +
<ref name="ref5">
 +
Yadav S R, Khanday I, Majhi B B, et al. Auxin-responsive OsMGH3, a common downstream target of OsMADS1 and OsMADS6, controls rice floret fertility[J]. Plant and Cell Physiology, 2011, 52(12): 2123-2135. </ref>
 +
</references>
 +
 
 +
 
  
 
==Structured Information==
 
==Structured Information==

Revision as of 03:05, 6 August 2013

The rice Os02g0682200 has been reported as MADS6 or MFO1 more than four times since the year 2009. As a member of MADS-box gene family, MADS6 draws attention of plant molecular biologists for its special functions in the regulation of rice flowers development[1][2][3][4][5].

Annotated Information

Figure 1. osmads6 mutant VS. WT( from reference [2]).

Function

OsMADS6, the AGL6-like gene in rice, plays an essential role in specifying floral organ, meristem identities and endosperm nutrient accumulation in rice[1][2][3]. It is also an important epigenetic regulator in rice[3]. The study by Shinnosuke Ohmori et al. in 2009 showed that the loss of OsMADS6 function in rice resulted in aberrant floral morphology[1]. The study by Dabing Zhanga et al. in 2011 further explained how OsMADS6 worked with MADS3, MADS16, MADS13 and MADS58 et al. and showed that MADS6 is a key player in specifying flower development via interacting with other floral homeotic genes in rice[4].

GO assignment(s): GO:0003700, GO:0005634, GO:0043565

Wild Type VS. Mutant

  • In the research reported by Dabing Zhang et al. in 2010, a osmads6 mutant line with flower morphological defects was isolated from Japonica subspecies 9522 background treated with 60-Co γ-ray (280 Gy)[2]. No significant differences were observed when comparing the vegetative development stages, flowering time or inflorescene morphology of Wild type and the osmads6 mutant (Figure 1A and 1B).
  • However, when comparing the morphology of flower organs, a defection of floral development could be found in osmads6 mutant. The spikelets of osmads6-1 at stage In9 showed somewhat larger palea than wild type (Figure 1C and 1D). The wellinterlocked lemma/palea structure was destroyed in the osmads6-1 mutant flower because of the altered marginal tissue (Figure 1F). Ectopic indeterminate glume-like structures enclosed the stamen filament in osmads6-1 mutant flowers (Figure 1G).

Figure 2. mfo1-1 mutant VS. WT (from reference[1]).
  • In the research reproted by Shinnosuke Ohmori et al. in 2009, another MADS6 mutant mfo1-1 was described[1]. There is also no obvious abnormalities between mfo1-1 and wild type in the vegetative stage, however, abnormal flower morphological was observed in mfo1-1. A slightly enlarged palea and were half open was found in the florets of mfo1-1 (Figure 2A and 2B).
  • Compared with wild type, Mfo1-1 is in defect of interlocking between the lemma and palea (Figure 2C and 2D). The mfo1-1 palea also lacked the membranous marginal region of palea which is found in wild type and its surface is relatively rougher then that of the wild-type lemma (Figures 2E and 2F).


Evolution

  • The phylogenetic analyses made by Dabing Zhang et al. OsMADS6 belonged to an ancient and conserved AGL6 family. Both gymnosperms and angiosperms shared one common ancestor of AGL6-like genes. And the AGL6-like genes from grasses form two paralogous clades: the OsMADS17-clade contains OsMADS17 gene with an ortholog from Sorghum and the other genes, namely, OsMADS6-clades [2].

Labs working on this gene

  • Rice Biotechnology Research Subteam (Hokuriku Region), National Agricultural Research Center, National Agriculture and Food Research Organization, Niigata 943-0193, Japan;
  • Division of Genome and Biodiversity Research, National Institute of Agrobiological Sciences, Ibaraki 305-8602, Japan;
  • School of Life Science and Biotechnology, Shanghai Jiaotong University, Shanghai 200240, China;
  • Department of Biochemistry and Molecular Biology, Mississippi State University, MS 39762, USA;
  • Institute of Plant Science, State Key Laboratory of Hybrid Rice, School of Life Sciences and Biotechnology, Shanghai Jiao Tong University, Shanghai 200240, China;
  • Dipartimento di Scienze Biomolecolari e Biotecnologie, Universita` degli Studi di Milano, 20133 Milan, Italy;
  • Bio-X Center, Key Laboratory of Genetics and Development and Neuropsychiatric Diseases, Ministry of Education, Shanghai Jiao Tong University, Shanghai 200240, China;
  • Department of Microbiology and Cell Biology, Indian Institute of Science, Bangalore-560012, India
  • Department of Plant Biotechnology, School of Biotechnology, Madurai Kamaraj University, Madurai-625 021, Tamil Nadu, India
  • Institute of Biotechnology, Viikinkaari 1, FI-00790, University of Helsinki, Finland

References

  1. 1.0 1.1 1.2 1.3 1.4 Ohmori S, Kimizu M, Sugita M, et al. MOSAIC FLORAL ORGANS1, an AGL6-like MADS box gene, regulates floral organ identity and meristem fate in rice[J]. The Plant Cell Online, 2009, 21(10): 3008-3025.
  2. 2.0 2.1 2.2 2.3 2.4 Li H, Liang W, Jia R, et al. The AGL6-like gene OsMADS6 regulates floral organ and meristem identities in rice[J]. Cell research, 2009, 20(3): 299-313.
  3. 3.0 3.1 3.2 Zhang J, Nallamilli B R, Mujahid H, et al. OsMADS6 plays an essential role in endosperm nutrient accumulation and is subject to epigenetic regulation in rice (Oryza sativa)[J]. The Plant Journal, 2010, 64(4): 604-617.
  4. 4.0 4.1 Li H, Liang W, Hu Y, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate[J]. The Plant Cell Online, 2011, 23(7): 2536-2552.
  5. Yadav S R, Khanday I, Majhi B B, et al. Auxin-responsive OsMGH3, a common downstream target of OsMADS1 and OsMADS6, controls rice floret fertility[J]. Plant and Cell Physiology, 2011, 52(12): 2123-2135.


Structured Information

Gene Name

Os02g0682200

Description

Similar to MADS box protein

Version

NM_001054284.1 GI:115447938 GeneID:4330328

Length

7968 bp

Definition

Oryza sativa Japonica Group Os02g0682200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:28762840..28770807

Sequence Coding Region

28762972..28763153,28765912..28765990,28767927..28767988,28768220..28768319,28769648..28769689
,28769999..28770040,28770138..28770283,28770460..28770559

Expression

GEO Profiles:Os02g0682200

Genome Context

<gbrowseImage1> name=NC_008395:28762840..28770807 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:28762840..28770807 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggggaggggaagagttgagctgaagcgcatcgagaacaagatcaacaggcaggtcaccttctccaagcgccgcaacggcctcctcaagaaggcctacgagctgtccgttctctgcgacgccgaggtcgcgctcatcatcttctccagccgcggcaagctctacgagttcggcagcgccggcataacaaagactttagaaaggtaccaacattgttgctacaatgctcaagattccaacaatgcactttctgaaacccagagttggtaccatgaaatgtcaaagttgaaagcaaaatttgaagctttgcagcgcactcaaaggcacttgcttggggaggatcttggaccactcagcgtcaaagaattgcagcagctggagaaacagcttgaatgtgcactatcacaggcgagacagagaaagacgcaactgatgatggaacaagtggaggaacttcgcagaaaggagcgtcagctgggtgaaattaataggcaactcaagcacaagctcgaggttgaaggttccaccagcaactacagagccatgcagcaagcctcctgggctcagggcgccgtggtggagaatggcgccgcatacgtgcagccgccgccacactccgcggccatggactctgaacccaccttgcaaattgggtatcctcatcaatttgtgcctgctgaagcaaacactattcagaggagcactgcccctgcaggtgcagagaacaacttcatgctgggatgggttctttga</cdnaseq>

Protein Sequence

<aaseq>MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVA LIIFSSRGKLYEFGSAGITKTLERYQHCCYNAQDSNNALSETQSWYHEMSKLKAKFEA LQRTQRHLLGEDLGPLSVKELQQLEKQLECALSQARQRKTQLMMEQVEELRRKERQLG EINRQLKHKLEVEGSTSNYRAMQQASWAQGAVVENGAAYVQPPPHSAAMDSEPTLQIG YPHQFVPAEANTIQRSTAPAGAENNFMLGWVL</aaseq>

Gene Sequence

<dnaseqindica>133..314#3073..3151#5088..5149#5381..5480#6809..6850#7160..7201#7299..7444#7621..7720#atattctcgtcatcattggaggctttagcaagcaagaagagaggcagtggtggtggtggtggaggaggagctagctagcctgtgcttgctgatcggtgctgagctgaggaatcgttcgatcgatcgggcgagatggggaggggaagagttgagctgaagcgcatcgagaacaagatcaacaggcaggtcaccttctccaagcgccgcaacggcctcctcaagaaggcctacgagctgtccgttctctgcgacgccgaggtcgcgctcatcatcttctccagccgcggcaagctctacgagttcggcagcgccgggtataattaatacagacacaacaacacacacaaccaacaaaccagcatcaatttgaacctgcagatctgctgttttctctgatcaattgcttctttttttttgttcttttttgtttcttttatctgctgcaacggcgtcctgctcctctggggtttctcgttttctttttcatttatttttagcaggtgccaagtagccgagctactatacttacctggccatgttaattattttattccgtctgtctgtgtgtgtctgtgcatactactatagggacatggcgcggtgttcttataaaccgggaggccggatccctaactagcatgggaggatatcttttcagcggatctatacaaaccctactcctgctgacctctttcttccagtttctccgggtcttccttggattattattgcccatcttccgggttgtgcgtgtgtcagagacagctcgaacgataaatttctcaaaaccagtactagagagggtgtgttgtgtgtgagaactgagtggagagttagcatgaaggctgcaaactagaaaggaaggtatgttctttcctttttgatccatcaggggagccccttctggtattaagatctttccggcacattgattttcatactttgtgatgaccctggaagaatcggcgtagcagcgtagcaccgctccattttggtcttaccctcacctccccatgctatgaactgatcaatttcattgttcttcatcacccttctcctagctttccacttccttcggatctcatgccatgtttctcagcatgaatcaaatttaattcgtgttttctacttccatatatactggaagaaatttaattagatctatttttgctcgggaggtcttcatactttgagttctgatgccatcaccttatttcccccccccccttctcttgttctatcttcttcctcatcttggcttgatcattttgatctgtcagttatagcatgatgcattctcaatttgactgtatgtaagttcaaccggaaatatgttgaatggattttctatatatcaacacttgatgtcaggcctgcatctgtttcgcttgtggtggtgtggccaaaattgtctatatttgatctttgctcttctttctcctcatttcatgacgattcctactacggcttaaaccattctttattctttactaatcatggatgttgcttgactcctagttgtttcgtactagctcaacttggagatcttttcattatttgcctagttggtgggtacgtttgtgacagatctaaaatggtgcacgaaaagttttacttattatgaaaaaagggagcttaacagggtaatttctctatttattcgtgatgacattttttccttgataagggggattttttataatctgcactcacatgtttatatgtaaaatctagctcttttgttttgtttttggcatatttcccgctaagtatagagtttatgtggataacattataacttttcaagatccaatccacatctttgattgtgaaaatcatacaatagggaaaatcaactgaagggttaattagatgctatatgcatatatatatatatgtgcgcgcgcgcgcgcctgaatttaactatgtatgcatccaactgtttcattgaaaaagatttgatatttttcagtctattctttttcgagtatatatttaatatgtttcaatctgttttgaccattataagataaagcctatattcaccaggcatttgagatgatcttttcatgcatgaaaaagctgttgttatcacttcaactaaccagacgatctaacatgtatttgtataagaaacagaccttgatttccttctgtaaaatcatgcatgtgttcgttttgaattggagtcggcgcgcctgtgttttgaccgtcaggaaagtcttttttttccctgaatagtcaagggtctatacttcttgaagcaattgggacactaatcaattattgtttatacctcggaccatcttttccttcttcacaccactaatcagtttatgccttggaccattaattgtgttgttcacaagcttcttgtttatggtttacaaagcattcgcctagatttgtgtgtgtctctacacatcgatcacttttaaatacttgtcgctttcagttattcttttaacgtttggttatttatcttatttaaaaaaattatcgtattattatttattttgtttgtgatttactttattatcaaaagtatttcaaatatgacttatctttttttataagtgcactaatttttcaaataagatgaatggtcaaatgttacaagaaaaagttaaagcaaccactaatttagggcggaggtagtaaaacctagttattgtaaccaataattttatcaatctataaatgcaacacaaagtcacttcgtgatatctcacacaaagccacttcaacgatgaaagctgactgcatgttttatcaaaacacatgtgatcagtttgttggatgaaaaaaattatctatgtcataaatcaagagttataatataagcttctggctctacaagtaacatttctatgttttttttttacgttcttacatactatgttttgccaaaaaaaacatgatcattttgttggacgaaaagaaatagtaaatatagagtgacctttgatatcattataatataagcttctgcctctataaataacatctatgcactttttacgtcgtagtaatttgatatatgagaaatttacatataacatttttgtgcagcataacaaagactttagaaaggtaccaacattgttgctacaatgctcaagattccaacaatgcactttctgaaacccaggtatatatatctgcatgaactggtcatgaatttctgctgttggttttggtttcaaaatgggtcttgtttttttactatatatatttttgtatgaatatgcaattatcaatgtcctgacattgaaattagctacagtataaacctagctaggtattttcatcgtattgtgagattacattcaataaaaagtacacagattagcataactgtgttaatttgatgatgtatcccaaagctaatttgcagtgacttaaaatattttacttgacacagctactaaatcggatgttcttttcgtaaaagcattctaaagaatggcaaagtttagaagaattaaactagtagaatttcaacaccggcatgcattaaccatattttatgtaataaatgaagtttttattgacatgtcaaaggaggacaacaaagacaatcccttcttcctatatagttggtacccactacaagcattaacactataaagaagcatccaggttaagccacatcatcgataatcaatagccgtcggatcaaatgcatctttgtttgtttaactgtgcatgccttaagtaaggaaactgccatgggtaattaggcacatcaatggatgacccacttaagtgctcctggtcatgcattacatgcatcccccatattaagccactgctatatcccttaaccatctaccactcaaatgccaactttacactttattattttagaatgtttacttttgatatttcaattcttcaattctgtttgtaagcacatatttacaaagttgtttatcatcaccataaaatcccgtagcaacgcgcggggtatcaaactagttgtttgttataattataccatattacaatgcaagatcgtgctgtttacggcgtatatgtattcagaaatgttgcacctagtataggtttttaccagcatagaatatacaaatagctagtctaaatgactttttgtgcccctagctccctagtgtaaccttacatgaagtattccctgcatcgaatatgaagtatatattccctgcatcgacgaatatacaaatatactcctagctaggctaaaatacagccaccagtatgaagtaaattagtcgatgtagttcaatatttaaatatagatggtgattgaatgtacaacaatagtgcacatcccaaaaaaataagggtgtacctctgtgaccagatagtactccctcagtcagggtacgtccagattcattggactaggatatgtcacatccagtactagggccctgtttagattccaatttttttttcaaacttttaacttttccgtcacatcgaactttcctacatacaaacttccaacttttccgtcacatcgttccaatatcttcaaacttccaattttggcgtggaactaaacacagcctaggttggtttttcgtgggacggagggagtactctttatggtgattctaaatttcagtcaatcaattagagtacgtcctcataacatttcaaacaaaaacatagatgcccttgtgcataatttcaaaagtcatgagatcaaattgaaattcttgagaacttaccaaccgcaaaatatctaaggagttatgtcacttggttatatttatatcattgacatcctgcaacttatttgcccaataatcagtatatatagtttgctagctgtatcattaatagcatgtttcacaaaattttaaaaaaagaataagcccaacgtatatgtacaaggaggccatgtgacatatttagttaaaattcacaaacgacttttatcaagtgtttaaagaaaccgcagaaagttaatttgctctgtgtaacactaatattcagtgtatgattcgccaaacacacagttccttagtcgttagaactagctgataaatatttttgtgaactgaactaatggtttttcttttcctctgatcctgaagagttggtaccatgaaatgtcaaagttgaaagcaaaatttgaagctttgcagcgcactcaaaggtatttcactatgatctctccaagaagcataactcctgcaaatacacaatatatttttctataacatgcatgcaagtgataatgttgtgttaagggaaagagggaagaagcagcccataacgtgcatttacacacattattctgtaatatagctgctgcgaaactttatgtgtcatgcaatttaccttaatatttacattatgctctttgggttttgcttgattcttaaaggcacttgcttggggaggatcttggaccactcagcgtcaaagaattgcagcagctggagaaacagcttgaatgtgcactatcacaggcgagacagagaaaggtttatggcattctgcagtcctttgtttggaaccaaaatacttctgtttctagcctaccctggttcgcttgttatttgtccactgatttggatataggtgcaatacgtgagaagcaataaaatatacagtatgtctttagtttgtaggtaaagttatatatatttataaatagacaggaggtgtacgctagctatggaatatccccttgctaaagtttatataaagagcacctaactaatttgtttttgttcatggaagtgaacataataactgggaatgcttatcctacattatctaaagagaattgcataaaattgtttcaatctctagctaatgcatggtggtggtttggtagaaagccaagacatatttcacttagaatattgataccttattttatggtaaaggtcaactgatgatatttttaaagaagtgtgaaagctactatgcagcataagtaatccctttgtttcataaatttgccctaagtcattatctttaaccatcaatttctggaaatttgtgtagtttaacaaaatgtgaactgtacattctgtaaggatttttcatgttgtgtatctaacaacataacccttgtggtgttaaactatagtatcatttttttagaaactaatggtcaaaaatatatataagtgtttgaattaggacaaacgtagaatgacaagtaatttgaagcaactgggcgtagcatgtatcttgataaattcaccctattctaggcacgaaggtgatgcatacagtggcactaaatttcatataaaagactatctaagtatagaatagaaatatagaatggctagcacgcatgccctttttctttatatggatacatgtgtagtgacagggccgagcaactgcaacattaatctaaactgtcaatttcagatatactactacttatggctgcttgtttaggctaattaataattatatgtttactcttttcaaaataaaacacttcaaagctgcatgacaatcccgtcaacaaggatagtaatgacaatgagtagctgatgaaataatatggcttcaattctggagtttcaggaaaatttagctgctaaaaaaagaataagtgaataacccaaagaaaatagaactttgaaggatagaggtagagagattaaatatacactagtattcattttgtggtgcgtcgtacatgcttcaaaatctcccaaggaccataaaagatcccaagaaatagctaggtagaacacatgaaagttcagaaactggatataatctacacttcattatattactgtcaactcaatatgactgtgcttgaatggtttttgtgcagacgcaactgatgatggaacaagtggaggaacttcgcagaaaggtacattatcaatccaaagtttctcaagcatacatacagtatcagcattgccatgggcgggtgacttcaggagtgctagctactagtgataatctaaattaaaccacgaaatgacttggctagctttgacaatgcatctatattgccagcaaggctgctagggtataccgcatgcaagttaattagggtagatcgtgtagcctttgactgtataactaaagaaatggtagcttcgttcttgcgagagatttctttcatgagagttgttacatattatactatctccaatatatttttcttgtgccacaggagcgtcagctgggtgaaattaataggcaactcaagcacaaggttcttattcactcggaaatctgttatgccaatgcggtgcacatataattatttattgataattttcattcatatattctcatatccaatgctgcagctcgaggttgaaggttccaccagcaactacagagccatgcagcaagcctcctgggctcagggcgccgtggtggagaatggcgccgcatacgtgcagccgccgccacactccgcggccatggactctgaacccaccttgcaaattgggtaagattaatcaagaaaagccaagaccagaaatgcatatacttataacttctagctcaaatgcatacagctcgatcacagcatccgaactagtagaactaatgaaagattctcatcaaactgactgtgtatatcttgcttccattatattatctgaaaaacgattatgttactaggtatcctcatcaatttgtgcctgctgaagcaaacactattcagaggagcactgcccctgcaggtgcagagaacaacttcatgctgggatgggttctttgagctaagcagccatcgatcagctgtcagaagttggagctaataataaaagggatgtggagtgggctacatgtatctcggatctctctgcgagccacctaatggtcttgcgtggccctttaatctgtatgtttttgtgtgtaagctactgctagctgtttgcaccttctgcgtccgtggttgtgtttccgtgctacctttttatgttttgatttggatcttgtttgaaaataatcttaccagctttgggt</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0682200, RefSeq:Os02g0682200