Difference between revisions of "Os04g0542800"

From RiceWiki
Jump to: navigation, search
(Expression)
(Expression)
Line 17: Line 17:
 
* The histochemical ''GUS'' analysis of ''OsYSL16'' promoter made by ''Sichul Lee'' et al. showed that GUS activity was detected in seedling shoots, roots and reproductive organs under normal growing conditions (Figure 3). <ref name="ref3" />.<br><br>
 
* The histochemical ''GUS'' analysis of ''OsYSL16'' promoter made by ''Sichul Lee'' et al. showed that GUS activity was detected in seedling shoots, roots and reproductive organs under normal growing conditions (Figure 3). <ref name="ref3" />.<br><br>
 
* The study by ''Luqing Zheng'' et al. described the expression pattern of ''OsYSL16'' at great length:  ''OsYSL16'' was expressed in the roots, shoots, and basal regions (2 cm above the connection between the roots and shoots) at the vegetative stage<ref name="ref1" />. And the the expression of ''OsYSL16'' was slightly induced by Zn and Fe deficiency, but not by Mn and Cu deficiency (Figure 4)<ref name="ref1" />.
 
* The study by ''Luqing Zheng'' et al. described the expression pattern of ''OsYSL16'' at great length:  ''OsYSL16'' was expressed in the roots, shoots, and basal regions (2 cm above the connection between the roots and shoots) at the vegetative stage<ref name="ref1" />. And the the expression of ''OsYSL16'' was slightly induced by Zn and Fe deficiency, but not by Mn and Cu deficiency (Figure 4)<ref name="ref1" />.
 +
* Their Spatial expression analysis showed that ''OsYSL16'' was mainly expressed in the mature root zone but not in the root tip.At the basal node, ''OsYSL16'' was found in the phloem region of vascular bundles with a weaker expression in the enlarged vascular bundle.In the leaf blade, YSL16 was mainly expressed in vascular tissues. At the reproductive stage, a weaker expression was observed in the enlarged vascular bundle<ref name="ref1" />.<br><br>
  
 
===Evolution===
 
===Evolution===

Revision as of 03:34, 30 August 2013

The rice Os04g0542800 was reported as OsYSL16 more than three times since the year 2012. As a memeber of YSL (yellow stripe 1-like) gene family, it can regulate the trasportation of copper and iron ions [1][2][3][4].

Annotated Information

Figure 1. Wild-type lines VS. OsYSL16 knockout lines (from reference[1]).

Function

  • Yellow stripe-like16 (OsYSL16) encode an oligopeptide transport protein in rice and is involved in Cu distribution and redistribution[1]. It is a Cu-nicotianamine transporter which is required for delivering Cu to the developing young tissues and seeds through phloem transport[1].
Figure 2. Wild-type lines VS. OsYSL16 knockout lines (from reference[2]).
  • OsYSL16 also plays an important role in the allocation of iron(III)-deoxymugineic acid via the vascular bundles[2]. However, Enhanced expression of OsYSL16 could not increase Fe levels obviously in the vegetative tissues and mature seeds.[3]. OsYSL16 is just a member of the numerous Fe-transporters in rice, not the main body.

Wild Type & Mutations

Figure 3. GUS activity was constitutively detected at all developmental stages of spikelets (from reference[3]).
  • Transgenic analysis made by Luqing Zheng et al. showed that knockout of OsYSL16 could result in a higher Cu concentration in the older leaves but a lower concentration in the younger leaves at the vegetative stage[1].

  • At the reproductive stage the fertility of the OsYSL16-knockout line was significantly reduced compared with that of wild-type rice[1]. In the wild-type rice, the percentage of filled grain was 84.0%, while the YSL16-knockout line could only get a percentage of 67.0% (Figure 1). Their following complementary experiments showed that the fertility of complementation lines could return to normal lvevels of wild type, further confirming that the defect phenotype was caused by mutation of OsYSL16[1].

  • Yusuke Kakei et al. grew the OsYSL16-knockdown plants and wide-type plants under a Fe-deficiency condition. After three weeks, they found that the leaves of OsYSL16-knockdown plants became white and the plants almost died. While the wide-type plants were still alive and thier leaves remained yellow (Figure 2). This indicated that the OsYSL16-knockdown plants were more sensitive to Fe-deficiency than wild type plants[2].

Expression

  • In the study of Yusuke Kakei et al. The expression of OsYSL16 was typically observed around the xylem. In the vascular bundles of unelongated nodes, OsYSL16 was detected in the xylem of old leaves and the phloem of new leaves[2].
  • The histochemical GUS analysis of OsYSL16 promoter made by Sichul Lee et al. showed that GUS activity was detected in seedling shoots, roots and reproductive organs under normal growing conditions (Figure 3). [3].

  • The study by Luqing Zheng et al. described the expression pattern of OsYSL16 at great length: OsYSL16 was expressed in the roots, shoots, and basal regions (2 cm above the connection between the roots and shoots) at the vegetative stage[1]. And the the expression of OsYSL16 was slightly induced by Zn and Fe deficiency, but not by Mn and Cu deficiency (Figure 4)[1].
  • Their Spatial expression analysis showed that OsYSL16 was mainly expressed in the mature root zone but not in the root tip.At the basal node, OsYSL16 was found in the phloem region of vascular bundles with a weaker expression in the enlarged vascular bundle.In the leaf blade, YSL16 was mainly expressed in vascular tissues. At the reproductive stage, a weaker expression was observed in the enlarged vascular bundle[1].

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

  • Institute of Plant Science and Resources, Okayama University, Kurashiki 710-0046, Japan
  • Department of Biological Sciences, Dartmouth College, Hanover, New Hampshire, USA
  • Graduate School of Biotechnology, Kyung Hee University, Yongin 446-701, Korea
  • Department of Plant Molecular Systems Biotechnology and Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea
  • Research Institute for Bioresources and Biotechnology, Ishikawa
  • Prefectural University, 1-308 Suematsu, Nonoichi-machi, Ishikawa 921-8836, Japan
  • Key Laboratory of South China Agricultural Plant Genetics and Breeding, South China Botanical Garden, Chinese Academy of Sciences, Guangzhou 510650, People's Republic of China
  • Key Laboratory of Plant Resources Conservation and Sustainable Utilization, South China Botanical Garden, Chinese Academy of Sciences, Guangzhou 510650, People's Republic of China

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9 Zheng L, Yamaji N, Yokosho K, et al. YSL16 is a phloem-localized transporter of the copper-nicotianamine complex that is responsible for copper distribution in rice[J]. The Plant Cell Online, 2012, 24(9): 3767-3782.
  2. 2.0 2.1 2.2 2.3 2.4 Kakei Y, Ishimaru Y, Kobayashi T, et al. OsYSL16 plays a role in the allocation of iron[J]. Plant molecular biology, 2012, 79(6): 583-594.
  3. 3.0 3.1 3.2 3.3 Lee S, Ryoo N, Jeon J S, et al. Activation of rice Yellow Stripe1-Like 16 (OsYSL16) enhances iron efficiency[J]. Molecules and cells, 2012, 33(2): 117-126.
  4. Liu T, Zeng J, Xia K, et al. Evolutionary expansion and functional diversification of oligopeptide transporter gene family in rice[J]. Rice, 2012, 5(1): 1-14.

Structured Information

Gene Name

Os04g0542800

Description

Similar to Iron-phytosiderophore transporter protein yellow stripe 1

Version

NM_001059985.1 GI:115459699 GeneID:4336546

Length

3769 bp

Definition

Oryza sativa Japonica Group Os04g0542800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:27582526..27586294

Sequence Coding Region

27582813..27583741,27583832..27583949,27584088..27584277,27584402..27584536,27584658..27584755
,27585155..27585327,27585420..27585804

Expression

GEO Profiles:Os04g0542800

Genome Context

<gbrowseImage1> name=NC_008397:27582526..27586294 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:27582526..27586294 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggaccgccacgcgctgggcggcggtggcgcgctggagatcgagaagacgccggaggcggcggaggacatggagtcggagcccgcgctggcggcggcgcgcgaggcggagcgcgtcccgccgtggcgggagcaggtgaccgcccgcgggatggtggcggcgctgctgatcggcgtggtgtacacggtgatcgtgatgaagctgagcctcaccacggggctcatccccacgctcaacgtctccgccgcgctgctcgccttcctcgcgctccggggatggacgcacgcgctcgaccgcctcggcattgcctcccgccccttcacccgccaggagaacaccgtcatccagacctgcgccgtcgcctgctacaccatcggctacggcggtggattcgggtcgttcttgctggggctgaacaagaagacgtacgagctgtccggcgcgagcacgccggggaacgtgccggggagctacaaggagcccgggatcgggtggatgacggggttcctcctctccaccagcttcgtggggctcctcaccttgctccctctccgaaaggtgctggtcatcgactacaagctaacatatccaagtgggacagcgactgctgttctcataaacgggtttcacacgcctcaaggagataagaatgcgaaaaagcaagtccgtggattcctcaggtatttcggcatcagcttcttgtggagcttcttccagtggttctacaccggcggtgacgtctgcggattcctccagttccctacctttgggctgaaagcttggaaacatacatttttcttcgacttcagtctcacgtatgttggtgccgggatgatctgttctcaccttgtcaacctctctctcttgttcggcgcgatcctctcctggggaataatgtggccgctcatcggcaagcagaaggggaattggtactctgctaaggcatctgaaagtagcatgtcgggcctgttcggttacaagtccttcatctgcattgcacttctcgttggagatggcttctacaacttcgtcaaagtgatcgttgtcactctcaagagcgtacgcgaaagatcaaggcgcaggggtcttaacaacagagtggcggacgcggacaccatggcgatcgacgacatgcagcggaacgaggtgttcaaccgggacaacatcccgacctggatggcgtacaccgggtacacgctgctcagcgtcatcgccgtggtcctcatcccggtgatgttccggcaggtgaagtggtactacgtgatcatcgcgtacctgctggcgccggcgctggggttctgcaacgcctacggcacggggctcaccgacatgaacatggggtacaactacggcaagatcgcgctcttcatcttcgcggcgtgggccgggaaggacgacggcgtggtggccgggctcgtcgggtgcgggctggtgaagcagctggtgctcatctccgccgacctgatgcacgacttcaagacgggccacctgacgctgacctcgccgcggtcgatgctggtcgggcaggtggtgggcacgctgatggggtgcgtcgtcgcgccgctcaccttcttcctcttctacaaggcgttcgacgtcggcgaccccaacgggtactggaaggcgccgtacgcgctcatctaccggaacatggccatcatcggcgtggaggggttctcggcgctgccgaggcactgcctgcagctgtgcgcggggttcttcgcgttcgcggtgctcgccaacctggcgcgggacttcctgccgcgcaggtacgggcggtacatgccgctgcccatggccatggccgtgccgttcctcgtcggcgccagcttcgccatcgacatgtgcgccggcagcctcgtggtgttcctctggcacaggttcgacggcaagagggccgcgctgctcgtgccggccgtcgcgtccggcctcatctgcggcgacgggatttggacgttcccttcgtcgctgctcgcgctggccaaggtcaagccacccatctgcatgaagttcataccgggaaactag</cdnaseq>

Protein Sequence

<aaseq>MDRHALGGGGALEIEKTPEAAEDMESEPALAAAREAERVPPWRE QVTARGMVAALLIGVVYTVIVMKLSLTTGLIPTLNVSAALLAFLALRGWTHALDRLGI ASRPFTRQENTVIQTCAVACYTIGYGGGFGSFLLGLNKKTYELSGASTPGNVPGSYKE PGIGWMTGFLLSTSFVGLLTLLPLRKVLVIDYKLTYPSGTATAVLINGFHTPQGDKNA KKQVRGFLRYFGISFLWSFFQWFYTGGDVCGFLQFPTFGLKAWKHTFFFDFSLTYVGA GMICSHLVNLSLLFGAILSWGIMWPLIGKQKGNWYSAKASESSMSGLFGYKSFICIAL LVGDGFYNFVKVIVVTLKSVRERSRRRGLNNRVADADTMAIDDMQRNEVFNRDNIPTW MAYTGYTLLSVIAVVLIPVMFRQVKWYYVIIAYLLAPALGFCNAYGTGLTDMNMGYNY GKIALFIFAAWAGKDDGVVAGLVGCGLVKQLVLISADLMHDFKTGHLTLTSPRSMLVG QVVGTLMGCVVAPLTFFLFYKAFDVGDPNGYWKAPYALIYRNMAIIGVEGFSALPRHC LQLCAGFFAFAVLANLARDFLPRRYGRYMPLPMAMAVPFLVGASFAIDMCAGSLVVFL WHRFDGKRAALLVPAVASGLICGDGIWTFPSSLLALAKVKPPICMKFIPGN</aaseq>

Gene Sequence

<dnaseqindica>2554..3482#2346..2463#2018..2207#1759..1893#1540..1637#968..1140#491..875#gtggtggcgttcgtctgatcgtcgtctccgagcggtgctgctgttttcgcagggaggacagtacaggtgagaggtttctgcatgcggtgctcgttacaatttggtgttggattgtgcttttgctgcctttctggtttctgctcgtgatttgtggttcttttgttcgtcgccttgttggcctctgtcattactgacccccgtggagcagagtggcagatggccaaatgcctctggctttgctagaagccaattttataactaatcctgcccgtttcaattcaacggcgcttgtactcttctgtctaatgcaagggcgctgggcgcacatggatgggttgttggattgtgtcgccctggtacgcgtaaacaaatgtgctcacgattacatctctcccctgcagccgccgcggccaccggtgccgccgccgacgtctcggagctcgagctgctagtccccagggggggcgcctcgtcgggtgcggccggcagcatggaccgccacgcgctgggcggcggtggcgcgctggagatcgagaagacgccggaggcggcggaggacatggagtcggagcccgcgctggcggcggcgcgcgaggcggagcgcgtcccgccgtggcgggagcaggtgaccgcccgcgggatggtggcggcgctgctgatcggcgtggtgtacacggtgatcgtgatgaagctgagcctcaccacggggctcatccccacgctcaacgtctccgccgcgctgctcgccttcctcgcgctccggggatggacgcacgcgctcgaccgcctcggcattgcctcccgccccttcacccgccaggagaacaccgtcatccagacctgcgccgtcgcctgctacaccatcggctacggcggtagctctcctgtctcccctcccctctcatcaccccggccaatcttggcgtctcgttgcgctaaccgcgtcgcgcgttcgcgtggagcacaggtggattcgggtcgttcttgctggggctgaacaagaagacgtacgagctgtccggcgcgagcacgccggggaacgtgccggggagctacaaggagcccgggatcgggtggatgacggggttcctcctctccaccagcttcgtggggctcctcaccttgctccctctccgaaaggtacactactgactccctttgctcttctttgattttcccctttccatgccgtacctttcagcgtttaccgtttctgacagattccctgaattttccgagattgatctttactgtcatacgttctgaaaaaaatggcattggttgtacgatcgttcagcatcagagttgcaatcgttgaccacgattaacaaacattaaccatcgttttctccttttctcacttattaaggacctgttgtgtctttcagttatggtttggagtgctacagtacactactgataaagtctattctacacgtttattgtgtccttcagtctttttttttctgaacaaaaagtgggctaattatcgcaatcatgcaaaaatgaaggaatctgataaaaaccgatattttgcaggtgctggtcatcgactacaagctaacatatccaagtgggacagcgactgctgttctcataaacgggtttcacacgcctcaaggagataagaatgcgaagtaagctctttatttcagatttcagccaagtgctgatgaaatcatgattgagccgaccaaaaacgctgcagaaatagttgggattcactgacttgattcaatggtttcccctcaatgccagaaagcaagtccgtggattcctcaggtatttcggcatcagcttcttgtggagcttcttccagtggttctacaccggcggtgacgtctgcggattcctccagttccctacctttgggctgaaagcttggaaacatacgtaatttttttactgtttccatacaatttttatttactgtttctttttcactgatcattgtatgcttcagtggtaaagccgcaacaaaaacaactttttgctgagtaatttcttccatcaccagatttttcttcgacttcagtctcacgtatgttggtgccgggatgatctgttctcaccttgtcaacctctctctcttgttcggcgcgatcctctcctggggaataatgtggccgctcatcggcaagcagaaggggaattggtactctgctaaggcatctgaaagtagcatgtcgggcctgttcggttacaaggtgtgttcatcagttcacctgtcccaataatggtacatttgtagtactactagactagttcaggcagcacaatatatacacatttcctagctttttttttttttgaaaaaaaaaaactcaacatcgctacctgtgcagtccttcatctgcattgcacttctcgttggagatggcttctacaacttcgtcaaagtgatcgttgtcactctcaagagcgtacgcgaaagatcaaggcgcaggggtcttaacaacagaggtaaatgcaccgtaaaaaaagatttagatcgcctcgcgtattttcagttcaggctgaagcttacaggagtagttcattacgcatttgcagtggcggacgcggacaccatggcgatcgacgacatgcagcggaacgaggtgttcaaccgggacaacatcccgacctggatggcgtacaccgggtacacgctgctcagcgtcatcgccgtggtcctcatcccggtgatgttccggcaggtgaagtggtactacgtgatcatcgcgtacctgctggcgccggcgctggggttctgcaacgcctacggcacggggctcaccgacatgaacatggggtacaactacggcaagatcgcgctcttcatcttcgcggcgtgggccgggaaggacgacggcgtggtggccgggctcgtcgggtgcgggctggtgaagcagctggtgctcatctccgccgacctgatgcacgacttcaagacgggccacctgacgctgacctcgccgcggtcgatgctggtcgggcaggtggtgggcacgctgatggggtgcgtcgtcgcgccgctcaccttcttcctcttctacaaggcgttcgacgtcggcgaccccaacgggtactggaaggcgccgtacgcgctcatctaccggaacatggccatcatcggcgtggaggggttctcggcgctgccgaggcactgcctgcagctgtgcgcggggttcttcgcgttcgcggtgctcgccaacctggcgcgggacttcctgccgcgcaggtacgggcggtacatgccgctgcccatggccatggccgtgccgttcctcgtcggcgccagcttcgccatcgacatgtgcgccggcagcctcgtggtgttcctctggcacaggttcgacggcaagagggccgcgctgctcgtgccggccgtcgcgtccggcctcatctgcggcgacgggatttggacgttcccttcgtcgctgctcgcgctggccaaggtcaagccacccatctgcatgaagttcataccgggaaactagccaatgcatcgctgtaatttacagcgtcaatgcagacgtatagatcgtaaaaaaagagatcgtatagacgtatagcgtcaatgcagaaacactagaaaagagatcgtgtatcgagcgttttggacttagatttaagatttaggcgcagcgagaggaagaacgggtgtagctatgacggataaatccccaaaagcagaaatgctgttcataggggttggggttctgtactgtgtatatcagttgagaagaaaattagatgaaaacacaacaattagttgtgcttattg</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0542800, RefSeq:Os04g0542800