Difference between revisions of "Os02g0120500"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 4: Line 4:
 
===Function===
 
===Function===
 
* ''OsTDR'' is a key component of the molecular network regulating rice tapetum development and degeneration <ref name="ref1" /><ref name="ref2" />. As a member of [[bHLH]] family, ''OsTDR'' is a tapetal cell death regulator<ref name="ref1" /><ref name="ref2" /><ref name="ref3" /><ref name="ref4" />. It positively triggers programmed cell death (PCD) of tapetal cells and loss of ''OsTDR'' function could cause aborted tapetal PCD during pollen development<ref name="ref1" /><ref name="ref2" /><ref name="ref3" />.
 
* ''OsTDR'' is a key component of the molecular network regulating rice tapetum development and degeneration <ref name="ref1" /><ref name="ref2" />. As a member of [[bHLH]] family, ''OsTDR'' is a tapetal cell death regulator<ref name="ref1" /><ref name="ref2" /><ref name="ref3" /><ref name="ref4" />. It positively triggers programmed cell death (PCD) of tapetal cells and loss of ''OsTDR'' function could cause aborted tapetal PCD during pollen development<ref name="ref1" /><ref name="ref2" /><ref name="ref3" />.
 +
* In addition to its function in promoting tapetum PCD, ''OsTDR'' possibly plays some other crucial regulatory roles in several basic biological processes during rice pollen development, for example, aliphatic metabolism<ref name="ref2" /><ref name="ref3" />. It can regulate the synthesis of lipidic precursors during rice pollen wall development which might indirectly affect anther epidermis wax formation
  
 
===Expression===
 
===Expression===

Revision as of 09:50, 9 September 2013

The rice Os02g0120500 was reported as OsTDR since the year 2006 . It is involved with pollen development in rice[1][2][3][4].

Annotated Information

Figure 1. OsTDR Mutant VS. Wild-type(from reference)(from reference[1]).

Function

  • OsTDR is a key component of the molecular network regulating rice tapetum development and degeneration [1][2]. As a member of bHLH family, OsTDR is a tapetal cell death regulator[1][2][3][4]. It positively triggers programmed cell death (PCD) of tapetal cells and loss of OsTDR function could cause aborted tapetal PCD during pollen development[1][2][3].
  • In addition to its function in promoting tapetum PCD, OsTDR possibly plays some other crucial regulatory roles in several basic biological processes during rice pollen development, for example, aliphatic metabolism[2][3]. It can regulate the synthesis of lipidic precursors during rice pollen wall development which might indirectly affect anther epidermis wax formation

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os02g0120500

Description

Basic helix-loop-helix dimerisation region bHLH domain containing protein

Version

NM_001052245.1 GI:115443860 GeneID:4328113

Length

3152 bp

Definition

Oryza sativa Japonica Group Os02g0120500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:1073625..1076776

Sequence Coding Region

1073790..1074026,1074113..1074595,1074686..1075213,1075421..1075513,1075620..1075671
,1075800..1075904,1076020..1076180

Expression

GEO Profiles:Os02g0120500

Genome Context

<gbrowseImage1> name=NC_008395:1073625..1076776 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:1073625..1076776 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgggaagaggagaccacctgctgatgaagaacagcaatgctgctgcagctgcagctgctgtcaatggaggtggcaccagtttggatgctgcattgaggcctctagttggttcagatggctgggattactgcatctactggaggctctctcctgatcagaggttcttggagatgacaggattctgctgcagcagtgagcttgaagcacaggtctcagcactgctggacctgccttcttcaatcccactggactcctcctccatagggatgcatgcgcaggcattgctgtcgaaccagccgatctggcagagcagcagtgaggaggaggaggctgatggcggcggtggcgccaagacgcggctgctggtccccgtcgccggcggcctcgtcgagctcttcgcgtcgagatatatggcggaggagcagcagatggcggagcttgtcatggcgcagtgcggcggcggcggcgccggggacgacggtggggggcaggcgtggccgccgccggagacgcccagcttccagtgggacggaggcgccgacgcgcagaggctgatgtacggcggctcgtcgctgaacctgttcgacgccgccgccgccgacgacgacccgttcttgggtggtggtggtggtgacgccgtgggcgacgaggcggcggcggcgggcgcgtggccgtacgcggggatggcggtgagcgagccgtcggtggcggtggcgcaggagcagatgcagcacgcggcgggcggcggcgtggcggagtccgggtcggaggggaggaagctgcatggcggtgacccggaggacgacggcgacggcgaggggcgctccggcggcgccaagaggcagcagtgcaagaacctcgaggcggagaggaagcggaggaagaagctcaatggccacctctacaagctccgctcgctcgtcccaaacatcaccaagatggatcgcgcgtcgattcttggagacgcgatcgactacatcgtggggttgcagaagcaggtgaaggagctgcaggacgagctggaagacaaccatgtccaccataagccgcccgacgtgctcatcgaccacccgccgccggcgagcctcgtcgggctcgacaacgacgacgcctcgccgcccaacagccaccaacagcagccgccgctcgccgtttccggcagcagcagcaggaggagtaacaaggacccagcaatgaccgacgacaaggtcggcggcggcggcggcggtgggcaccggatggagccgcagctggaggtgcgtcaggtgcaggggaacgagctgttcgtccaggtgctctgggagcacaagcccggcgggttcgtccgcctcatggacgccatgaacgcgctcggcctcgaggtcatcaacgtcaacgtcaccacctacaagaccctcgtcctcaacgtcttccgcgtcatggtgagggacagcgaggtggcggtgcaggcggacagggtgagggactcgctgctggaggtgacgcgggagacgtaccccggcgtgtggccgtcgccgcaggaggaggacgacgccaagttcgacggcggcgacggcgggcaggctgcggcggcggcggcggcggccggtggagagcactaccacgacgaagtcggcggcggataccatcagcacctgcattacctcgcgtttgattga</cdnaseq>

Protein Sequence

<aaseq>MGRGDHLLMKNSNAAAAAAAVNGGGTSLDAALRPLVGSDGWDYC IYWRLSPDQRFLEMTGFCCSSELEAQVSALLDLPSSIPLDSSSIGMHAQALLSNQPIW QSSSEEEEADGGGGAKTRLLVPVAGGLVELFASRYMAEEQQMAELVMAQCGGGGAGDD GGGQAWPPPETPSFQWDGGADAQRLMYGGSSLNLFDAAAADDDPFLGGGGGDAVGDEA AAAGAWPYAGMAVSEPSVAVAQEQMQHAAGGGVAESGSEGRKLHGGDPEDDGDGEGRS GGAKRQQCKNLEAERKRRKKLNGHLYKLRSLVPNITKMDRASILGDAIDYIVGLQKQV KELQDELEDNHVHHKPPDVLIDHPPPASLVGLDNDDASPPNSHQQQPPLAVSGSSSRR SNKDPAMTDDKVGGGGGGGHRMEPQLEVRQVQGNELFVQVLWEHKPGGFVRLMDAMNA LGLEVINVNVTTYKTLVLNVFRVMVRDSEVAVQADRVRDSLLEVTRETYPGVWPSPQE EDDAKFDGGDGGQAAAAAAAAGGEHYHDEVGGGYHQHLHYLAFD</aaseq>

Gene Sequence

<dnaseqindica>2751..2987#2182..2664#1564..2091#1264..1356#1106..1157#873..977#597..757#agtatcatacataatttgacagccatttccgaagacttggtatcaatacatcatcagatagccatggctaaattcagaggaacacacacatgtgaactatatatatgcatgatgcaatagtccttctgtacaaaatgattcttcagttaccaatagctatcagctgatgcctctctcttccatctgttgatcactgccacagttcgtcagttagtttgaagcgatctcaggaagacagaaggtatctttctttctctgcttaattccaaaaattcactagaaaagatttcacatacaatcctgatgagccagaagaatgcagctttgatctctgtctctttaagttactgaaaatttgattcaacatagactgaattttcagactaaatctgtctctttagtctgatgaatattcagactgaatctgattgttcccttgctgtgatcataccctgaattttcgctgtatccttggtgacatcaacttatcctgtcctgacagcaagaaaaagcaggccttgtgaatgctgcaactgacacttgcatccattcttcttgctttcatgtgtcactgctagggcaagggtgatcaccacatgggaagaggagaccacctgctgatgaagaacagcaatgctgctgcagctgcagctgctgtcaatggaggtggcaccagtttggatgctgcattgaggcctctagttggttcagatggctgggattactgcatctactggaggctctctcctgatcagaggtatgtgattgattacttggcatatcatatcatatcatgcatgcaaagtagcaattacggtgtgatttattatctctgtagtgatatacaaccattaacacaaaattaatggcaggttcttggagatgacaggattctgctgcagcagtgagcttgaagcacaggtctcagcactgctggacctgccttcttcaatcccactggactcctcctccatagggtaaattgaatgattaatcaatcaatcgatacgtgttctgattacctgcaaaattgatggtttcttgtctagtaactctgaacatttgtatgcttggtgaatctgaatctctgtcactatccatcaaggatgcatgcgcaggcattgctgtcgaaccagccgatctggcagagcagcagtgtaagcaagattcatcactgaacccagtagctgaatctgaatctgaatctgaatctgaatatgaatctctgtcactgatgaggtgtgttgcttggatgcgtggcaggaggaggaggaggctgatggcggcggtggcgccaagacgcggctgctggtccccgtcgccggcggcctcgtcgagctcttcgcgtcgagatatgtgagtggtcggtcgttcgattggttagaggagtagtagttagagaggatgcggctgcggctgcggcggcggcggtggtggcggcggctcacgccatccgcgtgagccaacgaacgccggagagcttgcggttagctgcacgcaacggcctttgcgttttgcatggatgggttatatagatttgtgggttgatcggtgttggtgcagatggcggaggagcagcagatggcggagcttgtcatggcgcagtgcggcggcggcggcgccggggacgacggtggggggcaggcgtggccgccgccggagacgcccagcttccagtgggacggaggcgccgacgcgcagaggctgatgtacggcggctcgtcgctgaacctgttcgacgccgccgccgccgacgacgacccgttcttgggtggtggtggtggtgacgccgtgggcgacgaggcggcggcggcgggcgcgtggccgtacgcggggatggcggtgagcgagccgtcggtggcggtggcgcaggagcagatgcagcacgcggcgggcggcggcgtggcggagtccgggtcggaggggaggaagctgcatggcggtgacccggaggacgacggcgacggcgaggggcgctccggcggcgccaagaggcagcagtgcaagaacctcgaggcggagaggaagcggaggaagaagctcaatggccacctctacaagctccgctcgctcgtcccaaacatcaccaaggtatcttacctcctcgtcgatcgccatggccatgaacggatcaaaagcttcttcaaatcgatttccgtttgattttgcaacgaatcgtagatggatcgcgcgtcgattcttggagacgcgatcgactacatcgtggggttgcagaagcaggtgaaggagctgcaggacgagctggaagacaaccatgtccaccataagccgcccgacgtgctcatcgaccacccgccgccggcgagcctcgtcgggctcgacaacgacgacgcctcgccgcccaacagccaccaacagcagccgccgctcgccgtttccggcagcagcagcaggaggagtaacaaggacccagcaatgaccgacgacaaggtcggcggcggcggcggcggtgggcaccggatggagccgcagctggaggtgcgtcaggtgcaggggaacgagctgttcgtccaggtgctctgggagcacaagcccggcgggttcgtccgcctcatggacgccatgaacgcgctcggcctcgaggtcatcaacgtcaacgtcaccacctacaagaccctcgtcctcaacgtcttccgcgtcatggtagtacgccccgctcgccgccgccatggccatgaacgcgagctcgcgagctgactactccgagctggttggtttctgcattgcaggtgagggacagcgaggtggcggtgcaggcggacagggtgagggactcgctgctggaggtgacgcgggagacgtaccccggcgtgtggccgtcgccgcaggaggaggacgacgccaagttcgacggcggcgacggcgggcaggctgcggcggcggcggcggcggccggtggagagcactaccacgacgaagtcggcggcggataccatcagcacctgcattacctcgcgtttgattgatgatgatgattgattttaccatctacgtctcactactagtgtatacacactcgaattattcgagaaagaaacataatgctacgtactagtaataatggatttgataagtagttgtctagtatttgtgattaatggcatatatgcataatgacttgatgactgaaa</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0120500, RefSeq:Os02g0120500

  1. 1.0 1.1 1.2 1.3 1.4 Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. 2.0 2.1 2.2 2.3 2.4 Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. 3.0 3.1 3.2 3.3 Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. 4.0 4.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref4