Difference between revisions of "Os02g0120500"

From RiceWiki
Jump to: navigation, search
(Function)
(Wild Type & Mutations)
Line 7: Line 7:
 
'''GO assignment(s):''' GO:0005634, GO:0030528, GO:0045449
 
'''GO assignment(s):''' GO:0005634, GO:0030528, GO:0045449
 
===Wild Type & Mutations===
 
===Wild Type & Mutations===
 +
* The phenotype analysis made by ''Na Li'' et al. showed that there was no obvious difference between the ''OsTDR'' mutant plant and wild-type plant in vegetative and floral development (Figures 1A to 1D).  However, the ''tdr'' mutant plant failed to produce any viable pollen (Figures 1A to 1D). Compared with wild-type anthers, the mutant anthers were small and white, without any mature pollen grains (Figures 1E to 1H)<
  
 
===Expression===
 
===Expression===

Revision as of 09:52, 9 September 2013

The rice Os02g0120500 was reported as OsTDR since the year 2006 . It is involved with pollen development in rice[1][2][3][4].

Annotated Information

Figure 1. OsTDR Mutant VS. Wild-type(from reference)(from reference[1]).

Function

  • OsTDR is a key component of the molecular network regulating rice tapetum development and degeneration [1][2]. As a member of bHLH family, OsTDR is a tapetal cell death regulator[1][2][3][4]. It positively triggers programmed cell death (PCD) of tapetal cells and loss of OsTDR function could cause aborted tapetal PCD during pollen development[1][2][3].
  • In addition to its function in promoting tapetum PCD, OsTDR possibly plays some other crucial regulatory roles in several basic biological processes during rice pollen development, for example, aliphatic metabolism[2][3]. It can regulate the synthesis of lipidic precursors during rice pollen wall development which might indirectly affect anther epidermis wax formation[2].

GO assignment(s): GO:0005634, GO:0030528, GO:0045449

Wild Type & Mutations

  • The phenotype analysis made by Na Li et al. showed that there was no obvious difference between the OsTDR mutant plant and wild-type plant in vegetative and floral development (Figures 1A to 1D). However, the tdr mutant plant failed to produce any viable pollen (Figures 1A to 1D). Compared with wild-type anthers, the mutant anthers were small and white, without any mature pollen grains (Figures 1E to 1H)<

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os02g0120500

Description

Basic helix-loop-helix dimerisation region bHLH domain containing protein

Version

NM_001052245.1 GI:115443860 GeneID:4328113

Length

3152 bp

Definition

Oryza sativa Japonica Group Os02g0120500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:1073625..1076776

Sequence Coding Region

1073790..1074026,1074113..1074595,1074686..1075213,1075421..1075513,1075620..1075671
,1075800..1075904,1076020..1076180

Expression

GEO Profiles:Os02g0120500

Genome Context

<gbrowseImage1> name=NC_008395:1073625..1076776 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:1073625..1076776 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgggaagaggagaccacctgctgatgaagaacagcaatgctgctgcagctgcagctgctgtcaatggaggtggcaccagtttggatgctgcattgaggcctctagttggttcagatggctgggattactgcatctactggaggctctctcctgatcagaggttcttggagatgacaggattctgctgcagcagtgagcttgaagcacaggtctcagcactgctggacctgccttcttcaatcccactggactcctcctccatagggatgcatgcgcaggcattgctgtcgaaccagccgatctggcagagcagcagtgaggaggaggaggctgatggcggcggtggcgccaagacgcggctgctggtccccgtcgccggcggcctcgtcgagctcttcgcgtcgagatatatggcggaggagcagcagatggcggagcttgtcatggcgcagtgcggcggcggcggcgccggggacgacggtggggggcaggcgtggccgccgccggagacgcccagcttccagtgggacggaggcgccgacgcgcagaggctgatgtacggcggctcgtcgctgaacctgttcgacgccgccgccgccgacgacgacccgttcttgggtggtggtggtggtgacgccgtgggcgacgaggcggcggcggcgggcgcgtggccgtacgcggggatggcggtgagcgagccgtcggtggcggtggcgcaggagcagatgcagcacgcggcgggcggcggcgtggcggagtccgggtcggaggggaggaagctgcatggcggtgacccggaggacgacggcgacggcgaggggcgctccggcggcgccaagaggcagcagtgcaagaacctcgaggcggagaggaagcggaggaagaagctcaatggccacctctacaagctccgctcgctcgtcccaaacatcaccaagatggatcgcgcgtcgattcttggagacgcgatcgactacatcgtggggttgcagaagcaggtgaaggagctgcaggacgagctggaagacaaccatgtccaccataagccgcccgacgtgctcatcgaccacccgccgccggcgagcctcgtcgggctcgacaacgacgacgcctcgccgcccaacagccaccaacagcagccgccgctcgccgtttccggcagcagcagcaggaggagtaacaaggacccagcaatgaccgacgacaaggtcggcggcggcggcggcggtgggcaccggatggagccgcagctggaggtgcgtcaggtgcaggggaacgagctgttcgtccaggtgctctgggagcacaagcccggcgggttcgtccgcctcatggacgccatgaacgcgctcggcctcgaggtcatcaacgtcaacgtcaccacctacaagaccctcgtcctcaacgtcttccgcgtcatggtgagggacagcgaggtggcggtgcaggcggacagggtgagggactcgctgctggaggtgacgcgggagacgtaccccggcgtgtggccgtcgccgcaggaggaggacgacgccaagttcgacggcggcgacggcgggcaggctgcggcggcggcggcggcggccggtggagagcactaccacgacgaagtcggcggcggataccatcagcacctgcattacctcgcgtttgattga</cdnaseq>

Protein Sequence

<aaseq>MGRGDHLLMKNSNAAAAAAAVNGGGTSLDAALRPLVGSDGWDYC IYWRLSPDQRFLEMTGFCCSSELEAQVSALLDLPSSIPLDSSSIGMHAQALLSNQPIW QSSSEEEEADGGGGAKTRLLVPVAGGLVELFASRYMAEEQQMAELVMAQCGGGGAGDD GGGQAWPPPETPSFQWDGGADAQRLMYGGSSLNLFDAAAADDDPFLGGGGGDAVGDEA AAAGAWPYAGMAVSEPSVAVAQEQMQHAAGGGVAESGSEGRKLHGGDPEDDGDGEGRS GGAKRQQCKNLEAERKRRKKLNGHLYKLRSLVPNITKMDRASILGDAIDYIVGLQKQV KELQDELEDNHVHHKPPDVLIDHPPPASLVGLDNDDASPPNSHQQQPPLAVSGSSSRR SNKDPAMTDDKVGGGGGGGHRMEPQLEVRQVQGNELFVQVLWEHKPGGFVRLMDAMNA LGLEVINVNVTTYKTLVLNVFRVMVRDSEVAVQADRVRDSLLEVTRETYPGVWPSPQE EDDAKFDGGDGGQAAAAAAAAGGEHYHDEVGGGYHQHLHYLAFD</aaseq>

Gene Sequence

<dnaseqindica>2751..2987#2182..2664#1564..2091#1264..1356#1106..1157#873..977#597..757#agtatcatacataatttgacagccatttccgaagacttggtatcaatacatcatcagatagccatggctaaattcagaggaacacacacatgtgaactatatatatgcatgatgcaatagtccttctgtacaaaatgattcttcagttaccaatagctatcagctgatgcctctctcttccatctgttgatcactgccacagttcgtcagttagtttgaagcgatctcaggaagacagaaggtatctttctttctctgcttaattccaaaaattcactagaaaagatttcacatacaatcctgatgagccagaagaatgcagctttgatctctgtctctttaagttactgaaaatttgattcaacatagactgaattttcagactaaatctgtctctttagtctgatgaatattcagactgaatctgattgttcccttgctgtgatcataccctgaattttcgctgtatccttggtgacatcaacttatcctgtcctgacagcaagaaaaagcaggccttgtgaatgctgcaactgacacttgcatccattcttcttgctttcatgtgtcactgctagggcaagggtgatcaccacatgggaagaggagaccacctgctgatgaagaacagcaatgctgctgcagctgcagctgctgtcaatggaggtggcaccagtttggatgctgcattgaggcctctagttggttcagatggctgggattactgcatctactggaggctctctcctgatcagaggtatgtgattgattacttggcatatcatatcatatcatgcatgcaaagtagcaattacggtgtgatttattatctctgtagtgatatacaaccattaacacaaaattaatggcaggttcttggagatgacaggattctgctgcagcagtgagcttgaagcacaggtctcagcactgctggacctgccttcttcaatcccactggactcctcctccatagggtaaattgaatgattaatcaatcaatcgatacgtgttctgattacctgcaaaattgatggtttcttgtctagtaactctgaacatttgtatgcttggtgaatctgaatctctgtcactatccatcaaggatgcatgcgcaggcattgctgtcgaaccagccgatctggcagagcagcagtgtaagcaagattcatcactgaacccagtagctgaatctgaatctgaatctgaatctgaatatgaatctctgtcactgatgaggtgtgttgcttggatgcgtggcaggaggaggaggaggctgatggcggcggtggcgccaagacgcggctgctggtccccgtcgccggcggcctcgtcgagctcttcgcgtcgagatatgtgagtggtcggtcgttcgattggttagaggagtagtagttagagaggatgcggctgcggctgcggcggcggcggtggtggcggcggctcacgccatccgcgtgagccaacgaacgccggagagcttgcggttagctgcacgcaacggcctttgcgttttgcatggatgggttatatagatttgtgggttgatcggtgttggtgcagatggcggaggagcagcagatggcggagcttgtcatggcgcagtgcggcggcggcggcgccggggacgacggtggggggcaggcgtggccgccgccggagacgcccagcttccagtgggacggaggcgccgacgcgcagaggctgatgtacggcggctcgtcgctgaacctgttcgacgccgccgccgccgacgacgacccgttcttgggtggtggtggtggtgacgccgtgggcgacgaggcggcggcggcgggcgcgtggccgtacgcggggatggcggtgagcgagccgtcggtggcggtggcgcaggagcagatgcagcacgcggcgggcggcggcgtggcggagtccgggtcggaggggaggaagctgcatggcggtgacccggaggacgacggcgacggcgaggggcgctccggcggcgccaagaggcagcagtgcaagaacctcgaggcggagaggaagcggaggaagaagctcaatggccacctctacaagctccgctcgctcgtcccaaacatcaccaaggtatcttacctcctcgtcgatcgccatggccatgaacggatcaaaagcttcttcaaatcgatttccgtttgattttgcaacgaatcgtagatggatcgcgcgtcgattcttggagacgcgatcgactacatcgtggggttgcagaagcaggtgaaggagctgcaggacgagctggaagacaaccatgtccaccataagccgcccgacgtgctcatcgaccacccgccgccggcgagcctcgtcgggctcgacaacgacgacgcctcgccgcccaacagccaccaacagcagccgccgctcgccgtttccggcagcagcagcaggaggagtaacaaggacccagcaatgaccgacgacaaggtcggcggcggcggcggcggtgggcaccggatggagccgcagctggaggtgcgtcaggtgcaggggaacgagctgttcgtccaggtgctctgggagcacaagcccggcgggttcgtccgcctcatggacgccatgaacgcgctcggcctcgaggtcatcaacgtcaacgtcaccacctacaagaccctcgtcctcaacgtcttccgcgtcatggtagtacgccccgctcgccgccgccatggccatgaacgcgagctcgcgagctgactactccgagctggttggtttctgcattgcaggtgagggacagcgaggtggcggtgcaggcggacagggtgagggactcgctgctggaggtgacgcgggagacgtaccccggcgtgtggccgtcgccgcaggaggaggacgacgccaagttcgacggcggcgacggcgggcaggctgcggcggcggcggcggcggccggtggagagcactaccacgacgaagtcggcggcggataccatcagcacctgcattacctcgcgtttgattgatgatgatgattgattttaccatctacgtctcactactagtgtatacacactcgaattattcgagaaagaaacataatgctacgtactagtaataatggatttgataagtagttgtctagtatttgtgattaatggcatatatgcataatgacttgatgactgaaa</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0120500, RefSeq:Os02g0120500

  1. 1.0 1.1 1.2 1.3 1.4 Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. 2.0 2.1 2.2 2.3 2.4 2.5 Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. 3.0 3.1 3.2 3.3 Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. 4.0 4.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref4