Difference between revisions of "Os02g0120500"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
(Labs working on this gene)
Line 25: Line 25:
 
* School of Life Sciences, Shanghai University, Shanghai 200240, China
 
* School of Life Sciences, Shanghai University, Shanghai 200240, China
 
* School of Life Science and Biotechnology, Shanghai Jiao Tong University, Shanghai 200240, China
 
* School of Life Science and Biotechnology, Shanghai Jiao Tong University, Shanghai 200240, China
 +
* Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai 200032, China
 +
* Department of Biology, Huck Institutes of the Life Sciences, Pennsylvania State University, University Park, Pennsylvania 16082
 +
* Instrumental Analysis Center of Shanghai Jiao Tong University, Shanghai 200240, China
 +
* State Key Laboratory of Hybrid Rice, School of Life Sciences and Biotechnology, Shanghai Jiao Tong University, Shanghai, China.
 +
* Division of Plant Sciences, School of Biosciences, University of Nottingham, Loughborough, Leics, UK
 +
* Department of Energy Plant Research Laboratory, Michigan State University, East Lansing, Michigan, USA
  
 
==References==
 
==References==

Revision as of 09:55, 9 September 2013

The rice Os02g0120500 was reported as OsTDR since the year 2006 . It is involved with pollen development in rice[1][2][3][4].

Annotated Information

Figure 1. OsTDR Mutant VS. Wild-type(from reference)(from reference[1]).

Function

  • OsTDR is a key component of the molecular network regulating rice tapetum development and degeneration [1][2]. As a member of bHLH family, OsTDR is a tapetal cell death regulator[1][2][3][4]. It positively triggers programmed cell death (PCD) of tapetal cells and loss of OsTDR function could cause aborted tapetal PCD during pollen development[1][2][3].
  • In addition to its function in promoting tapetum PCD, OsTDR possibly plays some other crucial regulatory roles in several basic biological processes during rice pollen development, for example, aliphatic metabolism[2][3]. It can regulate the synthesis of lipidic precursors during rice pollen wall development which might indirectly affect anther epidermis wax formation[2].

GO assignment(s): GO:0005634, GO:0030528, GO:0045449

Wild Type & Mutations

  • The phenotype analysis made by Na Li et al. showed that there was no obvious difference between the OsTDR mutant plant and wild-type plant in vegetative and floral development (Figures 1A to 1D). However, the tdr mutant plant failed to produce any viable pollen (Figures 1A to 1D). Compared with wild-type anthers, the mutant anthers were small and white, without any mature pollen grains (Figures 1E to 1H)[1].
Figure 2. The expression of OsTDR by RT-PCR(from reference[1]).
  • Their further anther transverse sections study and transmission electron microscopy study suggested that the OsTDR mutation resulted in the defects in tapetum degeneration, then affecting microspore development, particularly exine formation[1].

Expression

  • The RT-PCR analysis made by Na Li et al. in 2006 showed that developing anther is the only organs that the expression of TDR can be detected, no vegetative organs or any other reproductive organs [1] (Figure 2). Their further RNA in situ hybridization showed that OsTDR expression is associated with the differentiation of tapetal cells during rice anther development.
  • The microarray analysis made by Da-Sheng Zhang et al. showed that 236 genes exhibited significantly different expression levels in tdr mutant compared with wild-type, including 154 up-regulated genes and 82 down-regulated gene, ssuggesting a regulatory role of OsTDR during rice pollen development[2].

Gene Structure

Figure 3. Structure of OsTDR (from NCBI BLASTP).

Evolution

Figure 4. The phylogenetic analysis of OsTDR(from reference[1]).
  • The phylogenetic analysis of OsTDR and its 12 related proteins made by Na Li et al. in 2006 showed that the most closest gene is AMS in Arabidopsis. OsTDR shares 32% identity with AtAMS which is also related with tapetum degeneration[1].

Labs working on this gene

  • Shanghai Jiao Tong University–Shanghai Institutes for Biological Sciences–Pennsylvania State University Joint Center for Life Sciences, School of Life Science and Biotechnology, Key Laboratory of Microbial Metabolism, Ministry of Education, Shanghai Jiao Tong University, Shanghai 200240, China
  • School of Life Sciences, Shanghai University, Shanghai 200240, China
  • School of Life Science and Biotechnology, Shanghai Jiao Tong University, Shanghai 200240, China
  • Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai 200032, China
  • Department of Biology, Huck Institutes of the Life Sciences, Pennsylvania State University, University Park, Pennsylvania 16082
  • Instrumental Analysis Center of Shanghai Jiao Tong University, Shanghai 200240, China
  • State Key Laboratory of Hybrid Rice, School of Life Sciences and Biotechnology, Shanghai Jiao Tong University, Shanghai, China.
  • Division of Plant Sciences, School of Biosciences, University of Nottingham, Loughborough, Leics, UK
  • Department of Energy Plant Research Laboratory, Michigan State University, East Lansing, Michigan, USA

References

Please input cited references here.

Structured Information

Gene Name

Os02g0120500

Description

Basic helix-loop-helix dimerisation region bHLH domain containing protein

Version

NM_001052245.1 GI:115443860 GeneID:4328113

Length

3152 bp

Definition

Oryza sativa Japonica Group Os02g0120500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:1073625..1076776

Sequence Coding Region

1073790..1074026,1074113..1074595,1074686..1075213,1075421..1075513,1075620..1075671
,1075800..1075904,1076020..1076180

Expression

GEO Profiles:Os02g0120500

Genome Context

<gbrowseImage1> name=NC_008395:1073625..1076776 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:1073625..1076776 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgggaagaggagaccacctgctgatgaagaacagcaatgctgctgcagctgcagctgctgtcaatggaggtggcaccagtttggatgctgcattgaggcctctagttggttcagatggctgggattactgcatctactggaggctctctcctgatcagaggttcttggagatgacaggattctgctgcagcagtgagcttgaagcacaggtctcagcactgctggacctgccttcttcaatcccactggactcctcctccatagggatgcatgcgcaggcattgctgtcgaaccagccgatctggcagagcagcagtgaggaggaggaggctgatggcggcggtggcgccaagacgcggctgctggtccccgtcgccggcggcctcgtcgagctcttcgcgtcgagatatatggcggaggagcagcagatggcggagcttgtcatggcgcagtgcggcggcggcggcgccggggacgacggtggggggcaggcgtggccgccgccggagacgcccagcttccagtgggacggaggcgccgacgcgcagaggctgatgtacggcggctcgtcgctgaacctgttcgacgccgccgccgccgacgacgacccgttcttgggtggtggtggtggtgacgccgtgggcgacgaggcggcggcggcgggcgcgtggccgtacgcggggatggcggtgagcgagccgtcggtggcggtggcgcaggagcagatgcagcacgcggcgggcggcggcgtggcggagtccgggtcggaggggaggaagctgcatggcggtgacccggaggacgacggcgacggcgaggggcgctccggcggcgccaagaggcagcagtgcaagaacctcgaggcggagaggaagcggaggaagaagctcaatggccacctctacaagctccgctcgctcgtcccaaacatcaccaagatggatcgcgcgtcgattcttggagacgcgatcgactacatcgtggggttgcagaagcaggtgaaggagctgcaggacgagctggaagacaaccatgtccaccataagccgcccgacgtgctcatcgaccacccgccgccggcgagcctcgtcgggctcgacaacgacgacgcctcgccgcccaacagccaccaacagcagccgccgctcgccgtttccggcagcagcagcaggaggagtaacaaggacccagcaatgaccgacgacaaggtcggcggcggcggcggcggtgggcaccggatggagccgcagctggaggtgcgtcaggtgcaggggaacgagctgttcgtccaggtgctctgggagcacaagcccggcgggttcgtccgcctcatggacgccatgaacgcgctcggcctcgaggtcatcaacgtcaacgtcaccacctacaagaccctcgtcctcaacgtcttccgcgtcatggtgagggacagcgaggtggcggtgcaggcggacagggtgagggactcgctgctggaggtgacgcgggagacgtaccccggcgtgtggccgtcgccgcaggaggaggacgacgccaagttcgacggcggcgacggcgggcaggctgcggcggcggcggcggcggccggtggagagcactaccacgacgaagtcggcggcggataccatcagcacctgcattacctcgcgtttgattga</cdnaseq>

Protein Sequence

<aaseq>MGRGDHLLMKNSNAAAAAAAVNGGGTSLDAALRPLVGSDGWDYC IYWRLSPDQRFLEMTGFCCSSELEAQVSALLDLPSSIPLDSSSIGMHAQALLSNQPIW QSSSEEEEADGGGGAKTRLLVPVAGGLVELFASRYMAEEQQMAELVMAQCGGGGAGDD GGGQAWPPPETPSFQWDGGADAQRLMYGGSSLNLFDAAAADDDPFLGGGGGDAVGDEA AAAGAWPYAGMAVSEPSVAVAQEQMQHAAGGGVAESGSEGRKLHGGDPEDDGDGEGRS GGAKRQQCKNLEAERKRRKKLNGHLYKLRSLVPNITKMDRASILGDAIDYIVGLQKQV KELQDELEDNHVHHKPPDVLIDHPPPASLVGLDNDDASPPNSHQQQPPLAVSGSSSRR SNKDPAMTDDKVGGGGGGGHRMEPQLEVRQVQGNELFVQVLWEHKPGGFVRLMDAMNA LGLEVINVNVTTYKTLVLNVFRVMVRDSEVAVQADRVRDSLLEVTRETYPGVWPSPQE EDDAKFDGGDGGQAAAAAAAAGGEHYHDEVGGGYHQHLHYLAFD</aaseq>

Gene Sequence

<dnaseqindica>2751..2987#2182..2664#1564..2091#1264..1356#1106..1157#873..977#597..757#agtatcatacataatttgacagccatttccgaagacttggtatcaatacatcatcagatagccatggctaaattcagaggaacacacacatgtgaactatatatatgcatgatgcaatagtccttctgtacaaaatgattcttcagttaccaatagctatcagctgatgcctctctcttccatctgttgatcactgccacagttcgtcagttagtttgaagcgatctcaggaagacagaaggtatctttctttctctgcttaattccaaaaattcactagaaaagatttcacatacaatcctgatgagccagaagaatgcagctttgatctctgtctctttaagttactgaaaatttgattcaacatagactgaattttcagactaaatctgtctctttagtctgatgaatattcagactgaatctgattgttcccttgctgtgatcataccctgaattttcgctgtatccttggtgacatcaacttatcctgtcctgacagcaagaaaaagcaggccttgtgaatgctgcaactgacacttgcatccattcttcttgctttcatgtgtcactgctagggcaagggtgatcaccacatgggaagaggagaccacctgctgatgaagaacagcaatgctgctgcagctgcagctgctgtcaatggaggtggcaccagtttggatgctgcattgaggcctctagttggttcagatggctgggattactgcatctactggaggctctctcctgatcagaggtatgtgattgattacttggcatatcatatcatatcatgcatgcaaagtagcaattacggtgtgatttattatctctgtagtgatatacaaccattaacacaaaattaatggcaggttcttggagatgacaggattctgctgcagcagtgagcttgaagcacaggtctcagcactgctggacctgccttcttcaatcccactggactcctcctccatagggtaaattgaatgattaatcaatcaatcgatacgtgttctgattacctgcaaaattgatggtttcttgtctagtaactctgaacatttgtatgcttggtgaatctgaatctctgtcactatccatcaaggatgcatgcgcaggcattgctgtcgaaccagccgatctggcagagcagcagtgtaagcaagattcatcactgaacccagtagctgaatctgaatctgaatctgaatctgaatatgaatctctgtcactgatgaggtgtgttgcttggatgcgtggcaggaggaggaggaggctgatggcggcggtggcgccaagacgcggctgctggtccccgtcgccggcggcctcgtcgagctcttcgcgtcgagatatgtgagtggtcggtcgttcgattggttagaggagtagtagttagagaggatgcggctgcggctgcggcggcggcggtggtggcggcggctcacgccatccgcgtgagccaacgaacgccggagagcttgcggttagctgcacgcaacggcctttgcgttttgcatggatgggttatatagatttgtgggttgatcggtgttggtgcagatggcggaggagcagcagatggcggagcttgtcatggcgcagtgcggcggcggcggcgccggggacgacggtggggggcaggcgtggccgccgccggagacgcccagcttccagtgggacggaggcgccgacgcgcagaggctgatgtacggcggctcgtcgctgaacctgttcgacgccgccgccgccgacgacgacccgttcttgggtggtggtggtggtgacgccgtgggcgacgaggcggcggcggcgggcgcgtggccgtacgcggggatggcggtgagcgagccgtcggtggcggtggcgcaggagcagatgcagcacgcggcgggcggcggcgtggcggagtccgggtcggaggggaggaagctgcatggcggtgacccggaggacgacggcgacggcgaggggcgctccggcggcgccaagaggcagcagtgcaagaacctcgaggcggagaggaagcggaggaagaagctcaatggccacctctacaagctccgctcgctcgtcccaaacatcaccaaggtatcttacctcctcgtcgatcgccatggccatgaacggatcaaaagcttcttcaaatcgatttccgtttgattttgcaacgaatcgtagatggatcgcgcgtcgattcttggagacgcgatcgactacatcgtggggttgcagaagcaggtgaaggagctgcaggacgagctggaagacaaccatgtccaccataagccgcccgacgtgctcatcgaccacccgccgccggcgagcctcgtcgggctcgacaacgacgacgcctcgccgcccaacagccaccaacagcagccgccgctcgccgtttccggcagcagcagcaggaggagtaacaaggacccagcaatgaccgacgacaaggtcggcggcggcggcggcggtgggcaccggatggagccgcagctggaggtgcgtcaggtgcaggggaacgagctgttcgtccaggtgctctgggagcacaagcccggcgggttcgtccgcctcatggacgccatgaacgcgctcggcctcgaggtcatcaacgtcaacgtcaccacctacaagaccctcgtcctcaacgtcttccgcgtcatggtagtacgccccgctcgccgccgccatggccatgaacgcgagctcgcgagctgactactccgagctggttggtttctgcattgcaggtgagggacagcgaggtggcggtgcaggcggacagggtgagggactcgctgctggaggtgacgcgggagacgtaccccggcgtgtggccgtcgccgcaggaggaggacgacgccaagttcgacggcggcgacggcgggcaggctgcggcggcggcggcggcggccggtggagagcactaccacgacgaagtcggcggcggataccatcagcacctgcattacctcgcgtttgattgatgatgatgattgattttaccatctacgtctcactactagtgtatacacactcgaattattcgagaaagaaacataatgctacgtactagtaataatggatttgataagtagttgtctagtatttgtgattaatggcatatatgcataatgacttgatgactgaaa</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0120500, RefSeq:Os02g0120500

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. 2.0 2.1 2.2 2.3 2.4 2.5 2.6 Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. 3.0 3.1 3.2 3.3 Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. 4.0 4.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref4