Difference between revisions of "Os12g0555500"

From RiceWiki
Jump to: navigation, search
(References)
(Annotated Information)
Line 13: Line 13:
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
 +
 +
===Gene Structure===
 +
The PBZ1 cDNA is 833 bp long and contain a major open reading frame of 474 bp that encode a putative protein of 158 amino acids with a predicted mol wt of 16,687 and a pi of 4.73. A putative polyadenylation signal (AATAAA) was found in the 3' non-coding region<ref name="ref1" />.
  
 
==Labs working on this gene==
 
==Labs working on this gene==

Revision as of 09:22, 11 September 2013

PBZ1, a PR10 family protein, has been shown to accumulate in tissues undergoing cell death/programmed cell death (PCD) in rice, it was first shown to be weakly induced only 3 days after treatment with a herbicide, probenazol.

Annotated Information

Function

PBZ1 gene has an important function during the disease resistance response in rice[1]. Numerous reports and researchers have hypothesized it as a molecular marker in rice self-defense, but the precise function of PBZ1 remains unknown[2][3][4]. In recent years, Sun et al. have demonstrated that the expression levels and localizations of PBZ1 dramatically coincided with tissues undergoing programmed cell death(PCD), namely, during leaf senescence, root aerenchyma formation, coleoptiles senescence, root cap, and seed aleurone layer[2].

  • Naoki et al. have showed that the time course of the accumulation of the PBZl mRNA after treatment with probenazole corresponds to that of the development of anti-rice blast activity, this gene is somewhat related to disease resistance, and it is not a simple nonspecific response to chemical stimulation[1].

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Gene Structure

The PBZ1 cDNA is 833 bp long and contain a major open reading frame of 474 bp that encode a putative protein of 158 amino acids with a predicted mol wt of 16,687 and a pi of 4.73. A putative polyadenylation signal (AATAAA) was found in the 3' non-coding region[1].

Labs working on this gene

  • Environmental Biotechnology National Core Research Center, Gyeongsang National University, Jinju 660-701, Korea
  • Department of Plant Bioscience, Pusan National University, Busan 609-735, Korea
  • United Graduate School, Tokyo Uni_ersity of Agriculture and Technology, Tokyo, Japan
  • Food Function Laboratory, Ibaraki Uni_ersity, Ami, Ibaraki, Japan
  • National Institute of Agricultural Biotechnology,Rural Development Administration,Suwon 440-707, South Korea
  • Pharmaceutical Research Center, Meiji Seika Kaisha, Ltd., Morooka-cho, Kohoku-ku, Yokohama, 222 Japan

References

  1. 1.0 1.1 1.2 Midoh N, Iwata M. Cloning and characterization of a probenazole-inducible gene for an intracellular pathogenesis-related protein in rice[J]. Plant and cell physiology, 1996, 37(1): 9-18.
  2. 2.0 2.1 Kim S T, Kim S G, Kang Y H, et al. Proteomics analysis of rice lesion mimic mutant (spl 1) reveals tightly localized probenazole-induced protein (PBZ1) in cells undergoing programmed cell death[J]. Journal of proteome research, 2008, 7(4): 1750-1760.
  3. Rakwal R, Agrawal G K, Yonekura M. Light-dependent induction of OsPR10 in rice (Oryza sativa L.) seedlings by the global stress signaling molecule jasmonic acid and protein phosphatase 2A inhibitors[J]. Plant Science, 2001, 161(3): 469-479.
  4. Kim S G, Kim S T, Wang Y, et al. The RNase activity of rice probenazole-induced protein1 (PBZ1) plays a key role in cell death in plants[J]. Molecules and cells, 2011, 31(1): 25-31.

Structured Information

Gene Name

Os12g0555500

Description

Probenazole-inducible protein PBZ1

Version

NM_001073530.1 GI:115489021 GeneID:4352491

Length

1152 bp

Definition

Oryza sativa Japonica Group Os12g0555500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 12

Location

Chromosome 12:22803752..22804903

Sequence Coding Region

22803834..22804008,22804330..22804631

Expression

GEO Profiles:Os12g0555500

Genome Context

<gbrowseImage1> name=NC_008405:22803752..22804903 source=RiceChromosome12 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008405:22803752..22804903 source=RiceChromosome12 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggctccggcctgcgtctccgacgagcacgccgtcgcggtgtcggcggagcggctgtggaaggcgttcatggacgcgtccactttgcccaaggcctgcgccggcttggtcgacgacattgcggtcgaggggaacggtggtccgggcaccatctacaccatgaagcttaaccctgccgcgggtgtgggaagcacatacaagacccgggtggcggtgtgcgacgccgcaagtcatgtcctaaagtcggatgtgctcgaggcagaaagcaaggtggggaagctcaagtcacactcgacggagacgaagcttgaggccaccggcgatggctcctgtgtggccaagctcaaggtggagtacgagctcgaggacggcagctcactgtcgccggagaaggagaaggacatcgtggatggctactatggcatgctcaagatgatcgaggactacctcgtcgctcaccctgccgaatacgcctaa</cdnaseq>

Protein Sequence

<aaseq>MAPACVSDEHAVAVSAERLWKAFMDASTLPKACAGLVDDIAVEG NGGPGTIYTMKLNPAAGVGSTYKTRVAVCDAASHVLKSDVLEAESKVGKLKSHSTETK LEATGDGSCVAKLKVEYELEDGSSLSPEKEKDIVDGYYGMLKMIEDYLVAHPAEYA</aaseq>

Gene Sequence

<dnaseqindica>83..257#579..880#cagctctagctagctacaggcatcagtggtcagtagagtgatcagttgcaactagctagctagttagattatatcttcagtgatggctccggcctgcgtctccgacgagcacgccgtcgcggtgtcggcggagcggctgtggaaggcgttcatggacgcgtccactttgcccaaggcctgcgccggcttggtcgacgacattgcggtcgaggggaacggtggtccgggcaccatctacaccatgaagcttaaccctggtaggtccagaaagatctaagtacttgtatctactgattgtacttattatctcggccgattttttttcttaaatttttgtgaatttggtcaaaatttagtcaaattcagttaaattattttcaaatttctgaaaaaaaaatcagtccaaaaagtgccgaaaatcccgaaattttggttctaccaaaatggctttcggcgaaatcgaaagtgaaaatcctgtcaacaacaaaaagaatttgattaagacagttaaaattactatagtgcagtataaaattgattgggtatataataacaacaaatgttaaaattatatgcagccgcgggtgtgggaagcacatacaagacccgggtggcggtgtgcgacgccgcaagtcatgtcctaaagtcggatgtgctcgaggcagaaagcaaggtggggaagctcaagtcacactcgacggagacgaagcttgaggccaccggcgatggctcctgtgtggccaagctcaaggtggagtacgagctcgaggacggcagctcactgtcgccggagaaggagaaggacatcgtggatggctactatggcatgctcaagatgatcgaggactacctcgtcgctcaccctgccgaatacgcctaagatgaagaggaatactgcctctatccagtatatcccacctagagtgagtgataattaaataatgagagccgcagaaatgtccaaattctcgtggcgtttgagtccgtgagagtaatttcgtgctttaagtttgtggttgtgtttatgtgcctttctatggtcgtattcagtgttaaagttatcattttgcttcatcaatgggtgaataaagagaggcaagtctgaatgtgttctgctatggtttggaggttaatatggaagattgaaaatca</dnaseqindica>

External Link(s)

NCBI Gene:Os12g0555500, RefSeq:Os12g0555500