Difference between revisions of "Os08g0174500"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 8: Line 8:
 
* ''OsDTH8'' can also influence plant height and yield potential by the regulation of stem growth and panicle development <ref name="ref1" /><ref name="ref2" /><ref name="ref3" />. It was considerd that ''OsDTH8'' could provide a hard-won opportunity for molecular mechanism exploration of the relationship between grain yield and heading potential<ref name="ref2" />.<br><br>
 
* ''OsDTH8'' can also influence plant height and yield potential by the regulation of stem growth and panicle development <ref name="ref1" /><ref name="ref2" /><ref name="ref3" />. It was considerd that ''OsDTH8'' could provide a hard-won opportunity for molecular mechanism exploration of the relationship between grain yield and heading potential<ref name="ref2" />.<br><br>
 
'''GO assignment(s):''' GO:0003677, GO:0005622, GO:0005634, GO:0043565
 
'''GO assignment(s):''' GO:0003677, GO:0005622, GO:0005634, GO:0043565
 +
===Wild Type & Mutants===
  
 
===Expression===
 
===Expression===

Revision as of 08:31, 17 September 2013

The rice Os08g0174500 is a major QTL located at chromosome 8 of rice with pleiotropic effects on grain yield, heading date, and plant height[1][2][3]. It was reported as DTH8, Ghd8 and LHD1 in 2010, 2011 and 2012, espectively[1][2][3].

Annotated Information

Figure 1. Phenotypes of Asominori and chromosome segment substitution line of OsDTH8(CSSL61). The left is Asominori and right is CSSL61 (from reference[1]).

Function

  • Grain yield, heading date, and plant height have been regarded as the three most important agronomic traits of rice regulated by many quantitative trait loci (QTLs). OsDTH8 is a major QLT encoding a putative HAP3/NF-YB/CBF-A subunit of the CCAAT-box-binding transcription factor which suppress flowering by down-regulating several important floral transition activators, such as Ehd1, Hd3a and RFT1[1][2][3].

  • OsDTH8 can also influence plant height and yield potential by the regulation of stem growth and panicle development [1][2][3]. It was considerd that OsDTH8 could provide a hard-won opportunity for molecular mechanism exploration of the relationship between grain yield and heading potential[2].

GO assignment(s): GO:0003677, GO:0005622, GO:0005634, GO:0043565

Wild Type & Mutants

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os08g0174500

Description

Similar to HAP3

Version

NM_001067642.1 GI:115475020 GeneID:4344784

Length

1640 bp

Definition

Oryza sativa Japonica Group Os08g0174500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 8

Location

Chromosome 8:4332728..4334367

Sequence Coding Region

4332849..4333742

Expression

GEO Profiles:Os08g0174500

Genome Context

<gbrowseImage1> name=NC_008401:4332728..4334367 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008401:4332728..4334367 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgaagagtaggaagagctatgggcacttgctgagcccggtgggcagcccgccgttggacaacgagtccggcgaggcggcggcggcggctgcggctggcggcggcggctgcgggagcagcgccgggtatgtcgtctacggcggcggcggcggtggggactcgccggcgaaggagcaggacaggttcctgccgatcgcgaacgtgagccgcatcatgaagcggtcgctgccggcgaacgccaagatctccaaggagtcgaaggagacggtgcaggagtgcgtgtcggagttcatcagcttcgttacaggcgaggcctccgacaagtgccagcgcgagaagcggaagaccatcaacggcgacgacctcctctgggccatgaccacgctggggttcgaggcctacgtcggcccgctcaagtcctacctcaaccgctaccgcgaggccgagggcgagaaggccgacgtgctcggcggcgccggcggcgccgccgcggcgcgccacggcgagggcggttgctgcggcggcggcggcggcggcgccgatggcgtcgtcatcgacgggcattacccgctcgccggcggcctgtcacactcacaccatggtcatcagcagcaggacggcggcggcgacgtcgggctcatgatgggcggcggcgacgccggcgtcgggtacaacgccggggccgggtcgacgacgacggcgttctacgcgccggcggcgacggcggcgtcagggaacaaggcgtactgcggcggcgacgggtcgagggtgatggagttcgagggcatcggcggcgaggaggagagcggaggcggcggcggcggcggcgagagggggttcgccggccacctccatggcgtgcaatggtttagactaaagaggaatactaattag</cdnaseq>

Protein Sequence

<aaseq>MKSRKSYGHLLSPVGSPPLDNESGEAAAAAAAGGGGCGSSAGYV VYGGGGGGDSPAKEQDRFLPIANVSRIMKRSLPANAKISKESKETVQECVSEFISFVT GEASDKCQREKRKTINGDDLLWAMTTLGFEAYVGPLKSYLNRYREAEGEKADVLGGAG GAAAARHGEGGCCGGGGGGADGVVIDGHYPLAGGLSHSHHGHQQQDGGGDVGLMMGGG DAGVGYNAGAGSTTTAFYAPAATAASGNKAYCGGDGSRVMEFEGIGGEEESGGGGGGG ERGFAGHLHGVQWFRLKRNTN</aaseq>

Gene Sequence

<dnaseqindica>626..1519#tcggtcattagtatatgttagtataaattaaataattaaacaccttaaacaatattttttcgtcgtagtttgatcatcacctaagattttttagtcttttcaaaatgatcatcagctaacaagtgtatctttatttatttgtgcaagaagtaaatgagcatcattgaatgcgctgcacacatgtaatgcaaacaaccaagttaatttttattggtgcaacggcgcgcactatttaaaacgtgacgcaatgcagcgatagagcaccttgatagataagaattaatttcagcatgatgtagattttgttatccttaatctctactcactttgcataggtaataaattaaaccgctgaactattactacatggtttacatgaaaggtgatcgggtagggacgagaatgtcgcgacacacataatatatatagtagcgtccttatgtttgctttgtgtccgcatcgataccgtcttcccactcgcatctcctcacctcctttccttctttaaaaggagagcatcaccactccatcctcaactcccataacctcccccttctctctctctctaactacacactctctctctagctagctagctagctatagctagtgttgttagcttcacatgaagagtaggaagagctatgggcacttgctgagcccggtgggcagcccgccgttggacaacgagtccggcgaggcggcggcggcggctgcggctggcggcggcggctgcgggagcagcgccgggtatgtcgtctacggcggcggcggcggtggggactcgccggcgaaggagcaggacaggttcctgccgatcgcgaacgtgagccgcatcatgaagcggtcgctgccggcgaacgccaagatctccaaggagtcgaaggagacggtgcaggagtgcgtgtcggagttcatcagcttcgttacaggcgaggcctccgacaagtgccagcgcgagaagcggaagaccatcaacggcgacgacctcctctgggccatgaccacgctggggttcgaggcctacgtcggcccgctcaagtcctacctcaaccgctaccgcgaggccgagggcgagaaggccgacgtgctcggcggcgccggcggcgccgccgcggcgcgccacggcgagggcggttgctgcggcggcggcggcggcggcgccgatggcgtcgtcatcgacgggcattacccgctcgccggcggcctgtcacactcacaccatggtcatcagcagcaggacggcggcggcgacgtcgggctcatgatgggcggcggcgacgccggcgtcgggtacaacgccggggccgggtcgacgacgacggcgttctacgcgccggcggcgacggcggcgtcagggaacaaggcgtactgcggcggcgacgggtcgagggtgatggagttcgagggcatcggcggcgaggaggagagcggaggcggcggcggcggcggcgagagggggttcgccggccacctccatggcgtgcaatggtttagactaaagaggaatactaattagctagctaggcacacgcgtagttttattattacttaattaccgcgttaattaattgttgatgctgatgctgtttaaaattgattctccttttgcatgaaatgtttgatggtatggtttaaaa</dnaseqindica>

External Link(s)

NCBI Gene:Os08g0174500, RefSeq:Os08g0174500

  1. 1.0 1.1 1.2 1.3 1.4 Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. 2.0 2.1 2.2 2.3 2.4 Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. 3.0 3.1 3.2 3.3 Cite error: Invalid <ref> tag; no text was provided for refs named ref3