Difference between revisions of "Os04g0599300"

From RiceWiki
Jump to: navigation, search
(Evolution)
(Labs working on this gene)
Line 33: Line 33:
 
==Labs working on this gene==
 
==Labs working on this gene==
 
Please input related labs here.
 
Please input related labs here.
Using the full-length EAT1 protein sequence to search available public databases and retrieved a total of 26 homologues from 10 diverse plant species from moss, pteridophytes, to angiosperms. The result show that EAT1 and three homologues from Sorghum bicolour (Sb04g030850), Zea mays (ZmLOC100282922) and Brachypodium distachyon (BradXP_003580474), respectively, were grouped in a subclade. EAT1 has one homologue from rice (OsbHLH142), which shares 40.8% identity with EAT1 in the HLH and DUF domains, and three homologues from Arabidopsis (AtbHLH091, AtbHLH089, AtbHLH010), which share an average of B40% identity with EAT1 in these two conserved domains
 
[[File:图5.jpg]]
 
  
 
==References==
 
==References==

Revision as of 13:47, 5 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. ETERNAL TAPETUM 1(EAT1), a basic helix-loop-helix transcription factor conserved in land plants, positively regulates programmed cell death in tapetal cells in rice anthers. eat1 exhibits delayed tapetal cell death and aborted pollen formation, causing complete male sterility[1]. EAT1 directly regulates the expression of OsAP25 and OsAP37, which encode aspartic proteases that induce programmed cell death. In addition, EAT1 can interact with the TAPETUM DEGENERATION RETARDATION (TDR)protein and acts downstream of TDR[1]. TDR is also a key factor in regulates programmed cell death in tapetal cells[2].

图1.jpg

Mutation

Please input expression information here. There are three kinds of EAT1 Mutation show in figure 2. The mutant exhibits normal vegetative development and female organ formation, but is completely male sterile and has shrunken anthers and aborted pollen grains (figure 3).图2.jpg图3.jpg

The eat1-1 mutant anthers appeared to undergo normal meiosis, forming tetrads of haploid microspores at late stage 8. But after stage 10, the eat1-1 mutant had thicker tapetal cells, and abnormal abortion of the anther locule microspores. The result of terminal deoxynucleotidyl transferase-mediated dUTP nick-end labeling (TUNEL) assay and transmission electron microscopy (TEM) suggesting eat1-1 mutant cause delayed and abnormal PCD in tapetal cell.

Expression

Please input expression information here. The result of qRT–PCR indicated that in the wild type, EAT1 is weakly expressed in roots, shoots and leaves, and highly expressed in the anther from stage 7 to 12, while a dramatic reduction in expression was detected in the anthers in all three eat1 alleles (Fig. 4a). In GUS stained EAT1pro:GUS transgenic flowers, GUS signals started to appear in anthers at stage 7, became stronger from stage 8 to 9, and were nearly undetectable at stage 12 (Fig. 4b). Further in situ RNA hybridization indicated that EAT1 is highly expressed in the tapetum (Fig. 4c).图4.jpg

Evolution

Please input evolution information here.

You can also add sub-section(s) at will. Please input related labs here. Using the full-length EAT1 protein sequence to search available public databases and retrieved a total of 26 homologues from 10 diverse plant species from moss, pteridophytes, to angiosperms. The result show that EAT1 and three homologues from Sorghum bicolour (Sb04g030850), Zea mays (ZmLOC100282922) and Brachypodium distachyon (BradXP_003580474), respectively, were grouped in a subclade. EAT1 has one homologue from rice (OsbHLH142), which shares 40.8% identity with EAT1 in the HLH and DUF domains, and three homologues from Arabidopsis (AtbHLH091, AtbHLH089, AtbHLH010), which share an average of B40% identity with EAT1 in these two conserved domains.

图5.jpg

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os04g0599300

Description

Basic helix-loop-helix dimerisation region bHLH domain containing protein

Version

NM_001060284.1 GI:115460297 GeneID:4336865

Length

3433 bp

Definition

Oryza sativa Japonica Group Os04g0599300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:30633942..30637374

Sequence Coding Region

30634155..30634250,30634354..30634773,30635587..30636465

Expression

GEO Profiles:Os04g0599300

Genome Context

<gbrowseImage1> name=NC_008397:30633942..30637374 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:30633942..30637374 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgattgttggggctggttactttgaggattcccacgatcaaagtctcatggcaggatctttgatccatgactcaaatcaagctcctgcaagcagtgaaaacacaagcattgatttgcagaaattcaaagtgcacccgtactcaacagaagctctctcgaatacggccaatctagctgaagctgcaagagcaattaaccaccttcaacatcaactagaaattgatttggagcaagaggttcccccagtagaaactgcaaactgggatccagctatctgcactataccagatcatatcatcaaccatcagtttagcgaagatccacaaaacatattggtggagcaacagatccagcagtatgattctgcactttatccaaatggtgtttacacacctgcaccagatctccttaatcttatgcagtgcacaatggctccagcattcccggcaacgacatccgtattcggtgacacaacactgaatggtactaactatttggatcttaacggtgaacttacaggagtagcagcggttccagacagtgggagtgggttgatgtttgctagtgattcagctctccagttagggtaccatggtactcaatctcatctaataaaggatatctgccactcgttgccccaaaattatgggttgtttcccagtgaggacgaacgagatgtgattattggtgttggaagtggagatctttttcaggagatagatgacaggcagtttgatagtgtacttgaatgcaggagagggaagggtgagttcggaaagggcaagggaaaagctaattttgcaactgagagagagaggcgggagcagctaaatgtgaagttcaggaccctaagaatgctcttcccaaatcctaccaagaatgacagggcctcaatagtaggtgatgccattgagtatatagatgagctcaatcgaacagtgaaggagctgaagatcctggtggaacagaagaggcatggaaataacaggagaaaggtgttaaagttggatcaagaggcagccgctgatggcgagagctcatcgatgaggccagtgagggatgatcaagacaatcagctccatggagccataaggagctcatgggttcagaggaggtcaaaggaatgccacgttgatgtccgcatagtggacgatgaagtaaacatcaagctcactgaaaagaagaaggccaactctctgcttcatgcagcaaaggttctagatgagttccagctcgagcttatccatgtagtgggtgggattataggtgatcaccatatattcatgttcaacactaaggtatcagaaggttcggcggtttatgcatgtgcagtggcaaagaagctccttcaagcagtggacgtgcaacaccaggccctcgacatattcaactaa</cdnaseq>

Protein Sequence

<aaseq>MIVGAGYFEDSHDQSLMAGSLIHDSNQAPASSENTSIDLQKFKV HPYSTEALSNTANLAEAARAINHLQHQLEIDLEQEVPPVETANWDPAICTIPDHIINH QFSEDPQNILVEQQIQQYDSALYPNGVYTPAPDLLNLMQCTMAPAFPATTSVFGDTTL NGTNYLDLNGELTGVAAVPDSGSGLMFASDSALQLGYHGTQSHLIKDICHSLPQNYGL FPSEDERDVIIGVGSGDLFQEIDDRQFDSVLECRRGKGEFGKGKGKANFATERERREQ LNVKFRTLRMLFPNPTKNDRASIVGDAIEYIDELNRTVKELKILVEQKRHGNNRRKVL KLDQEAAADGESSSMRPVRDDQDNQLHGAIRSSWVQRRSKECHVDVRIVDDEVNIKLT EKKKANSLLHAAKVLDEFQLELIHVVGGIIGDHHIFMFNTKVSEGSAVYACAVAKKLL QAVDVQHQALDIFN</aaseq>

Gene Sequence

<dnaseqindica>3125..3220#2602..3021#910..1788#tttgacctttattatatggtcataaagacccttcagcaaaatgattgttactgctatcggcattttctgttgtttttcttttggaatcaatcttgtgtgacaccattgtattgtttcatgtcttgccactataatagtcttggcatagcactggatctcatgagtctttgagccgcaaattcatgaacataagttctttccattcaaccgttggctgaggcaaagatacaggtatgttttttccagtgcttgctactactgtttgcaggatgcaaatcctaattagcattggtttatgtttctgtaaattagttgttaagttctatagaactttcaatcatactgaatttacagttcttacttttagtgatcagcttataataaatgaagtatatttggcattggcaatgatttcaagctactcagcattttactgattaattagtaaacttggggtggttgaagcacattttatcaaacatcaatatgaatatgattagaggcaaagaaagatggtaaggagtttgttaggtctgcaacaagcaaagttgcttcatgtctcattaatcatgctatatgcaacttctctacacggaataaacagacagacagattgcgtagcttaaactccacggctccatcttcccttgaaacaaccaaaacagctaagccaactgaaaattttcatgtccgattgaattatatccactgcttcattcatgttgagtagccctgtttcccttaatatgtgcattgcaagtaatttctattttagcactagattagcacccatctaagatgctatttgtccttcattttcatcctgtccttgattcttctgctcatatgtttttttacttgtgttggttttagatttggagcgaaggtgcctagcactgttttgccaaaatgattgttggggctggttactttgaggattcccacgatcaaagtctcatggcaggatctttgatccatgactcaaatcaagctcctgcaagcagtgaaaacacaagcattgatttgcagaaattcaaagtgcacccgtactcaacagaagctctctcgaatacggccaatctagctgaagctgcaagagcaattaaccaccttcaacatcaactagaaattgatttggagcaagaggttcccccagtagaaactgcaaactgggatccagctatctgcactataccagatcatatcatcaaccatcagtttagcgaagatccacaaaacatattggtggagcaacagatccagcagtatgattctgcactttatccaaatggtgtttacacacctgcaccagatctccttaatcttatgcagtgcacaatggctccagcattcccggcaacgacatccgtattcggtgacacaacactgaatggtactaactatttggatcttaacggtgaacttacaggagtagcagcggttccagacagtgggagtgggttgatgtttgctagtgattcagctctccagttagggtaccatggtactcaatctcatctaataaaggatatctgccactcgttgccccaaaattatgggttgtttcccagtgaggacgaacgagatgtgattattggtgttggaagtggagatctttttcaggagatagatgacaggcagtttgatagtgtacttgaatgcaggagagggaagggtgagttcggaaagggcaagggaaaagctaattttgcaactgagagagagaggcgggagcagctaaatgtgaagttcaggaccctaagaatgctcttcccaaatcctaccaaggttagtcttattcatcatcttgcaagttattagttgtttaggctgtaaataacttggtgattctcacattaacagacaaccactcagattttcaataatatttccatttgttactcatgctctgaagataatcaaaattttaaatatcctcatccatttattctcagagaactaatgattcaaaaactgccaacaccaatatagctccggtttagcaaatctctgtttttttacagatcacaaatacctaacagtaaatttataagtctgtgtattcatctaactggtataaattttgaaattatctgtccaaaatttcttcaagttgcgttaccacattttgatgcatatgtatatggaatatgctgtctgatatatcactcaacatgattgttttttgaaaaatagttcatcagtatgatgttctttactgataacagtgccatgttattaagggttgttttggttttaagccaaattatgccctaccaaattgttggcattttgaaaagttatttggcaaagtttggcttgccaccaaagttggtcaagttttggcactaccaatatattgacatggtaacaaatcaaaacacccctaattgtgttcatcctaaccaagtgagttagcccttctagttagctaggagaaagcaatagaagcattcagttcgatatttcctatgttccttgccttttttgtgtgttagcacattccacaatgttatcatcctcatgatgttacccttcaacaagattgtagcacttaaatatcttggttgtggcactaatgtgttacaaactgtgctctagaatgacagggcctcaatagtaggtgatgccattgagtatatagatgagctcaatcgaacagtgaaggagctgaagatcctggtggaacagaagaggcatggaaataacaggagaaaggtgttaaagttggatcaagaggcagccgctgatggcgagagctcatcgatgaggccagtgagggatgatcaagacaatcagctccatggagccataaggagctcatgggttcagaggaggtcaaaggaatgccacgttgatgtccgcatagtggacgatgaagtaaacatcaagctcactgaaaagaagaaggccaactctctgcttcatgcagcaaaggttctagatgagttccagctcgagcttatccatgtagtgggtgggattataggtgatcaccatatattcatgttcaacactaaggtaagtaacaattcagttttcttaaagtagaatcaaagattctttttgtcccattacacatgttagcatcgatagtaacgattcatcatccatggcaactcaggtatcagaaggttcggcggtttatgcatgtgcagtggcaaagaagctccttcaagcagtggacgtgcaacaccaggccctcgacatattcaactaatctttagcaacagtactgattatctgaacaatgtcctagattttcagttaccttgctgagcaaacttatttgaccaggattggagagaattttatctttagcactagctacctagcaaaacttcttaacaatttggccatgtaacggcttgctgctgtccggttgtacaccttaactagcctgactaggaaagctttgatgcttgtcttgtgt</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0599300, RefSeq:Os04g0599300