Difference between revisions of "Os01g0831000"
Lixiaoman13 (talk | contribs) (→Mutation) |
Lixiaoman13 (talk | contribs) (→Expression) |
||
| Line 14: | Line 14: | ||
===Expression=== | ===Expression=== | ||
| − | LAX cDNA is 1,080-bp in length cloned by screening a cDNA library prepared from very young inflorescences. Sequencing of the LAX cDNA revealed that the LAX gene is intronless and encodes an ORF of 215 aa. It encodes a basic helix–loop–helix transcription factor and is expressed in the boundary between the shoot apical meristem and the region of new meristem formation. This pattern of LAX expression was repeatedly observed in every axillary meristem. | + | LAX cDNA is 1,080-bp in length cloned by screening a cDNA library prepared from very young inflorescences. Sequencing of the LAX cDNA revealed that the LAX gene is intronless and encodes an ORF of 215 aa. It encodes a basic helix–loop–helix transcription factor and is expressed in the boundary between the shoot apical meristem and the region of new meristem formation. This pattern of LAX expression was repeatedly observed in every axillary meristem(as showed in fig2). |
| + | [[File:Expression pattern of the LAX gene..jpg|none|500px|caption]] | ||
===Evolution=== | ===Evolution=== | ||
Revision as of 08:20, 8 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
LAX PANICLE (LAX) is involved in the formation of all types of axillary meristems throughout the ontogeny of a rice plant. Ectopic LAX expression in rice caused pleiotropic effects, including dwarfing, an altered pattern of stem elongation, darker color, bending of the lamina joint, absence of the midribs of leaves, and severe sterility.
Mutation
In strong mutant alleles of the LAX locus, such as lax-2 and lax-3, the initiation of lateral spikelets is completely suppressed, and panicle branches are also severely reduced. On the other hand, the defects were observed only in the lateral spikelets in lax-1, lax-4, and lax-5, which are weak mutant alleles of LAX. An insertion of a retro transposon was detected in the lax-1 allele(as showed in fig1). The existence of a long deletion, which contains five predicted genes, PG1 to PG5, was identified in the lax-2 allele. A 59-bp region was deleted in lax-3. Amino acid substitutions were found in lax-4 and lax-5, R50D or A49T, respectively.
Expression
LAX cDNA is 1,080-bp in length cloned by screening a cDNA library prepared from very young inflorescences. Sequencing of the LAX cDNA revealed that the LAX gene is intronless and encodes an ORF of 215 aa. It encodes a basic helix–loop–helix transcription factor and is expressed in the boundary between the shoot apical meristem and the region of new meristem formation. This pattern of LAX expression was repeatedly observed in every axillary meristem(as showed in fig2).
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
1.Graduate School of Agriculture and Life Science, University of Tokyo, Yayoi 1-1-1, Bunkyo, Tokyo 113-8657, Japan; 2.Research Institute for Bioresources,Okayama University, Chuou 2-20-1, Kurashiki, Okayama 710-0046, Japan; 3.CREST, Japan Science and Technology Corporation, Honcho 4-1-8,Kawaguchi, Saitama 332-0012, Japan; 4.Department of Bio-Science, Nara Institute of Science and Technology, Takayama 8916-5,Ikoma, Nara 630-0101, Japan.
References
Please input cited references here.
Structured Information
| Gene Name |
Os01g0831000 |
|---|---|
| Description |
Transcription factor LAX PANICLE |
| Version |
NM_001051234.1 GI:115440838 GeneID:4327431 |
| Length |
1078 bp |
| Definition |
Oryza sativa Japonica Group Os01g0831000, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:37313995..37315072 |
| Sequence Coding Region |
37314110..37314757 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:37313995..37315072 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:37313995..37315072 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgcatgacccacgcggcttccccatccacccgcagccgtaccacctccaccccacggccggcggcctcggcgagggcaggatgcggggcggcgggcggcggcgccccggcgccaagctctccaccgacccgcagagcgtggcggcgcgggagcggcggcaccggatcagcgaccgcttccgcgtgctccgcagcctcgtgccgggcggcagcaagatggacacggtgtccatgctggagcaggccatccactacgtcaagttcctcaaggcgcaggtcaccctgcaccaggccgcgctcgtgcagcacgaggagggctgccagcacgccgacgtcgccgcggcgttctccgccgccgacgccgatctggcccttgagctgaaccatcgccacggcggcgccggcgatgatgacgccgggatgacgacgctggagatggcgccgatgcaagaggcggtgggctacggcgacggcccggctcatcagatgatgcagcaagcgctcgatccagcggggcagctgatgatgggcggcgctcatcagctgcctcctttgccttgctgtgtcttcgtccaggagactgacccctcgtgctactcggtgtgcaatgtccacggtgaggagtctggtgcgcaaggatcttattag</cdnaseq> |
| Protein Sequence |
<aaseq>MHDPRGFPIHPQPYHLHPTAGGLGEGRMRGGGRRRPGAKLSTDP QSVAARERRHRISDRFRVLRSLVPGGSKMDTVSMLEQAIHYVKFLKAQVTLHQAALVQ HEEGCQHADVAAAFSAADADLALELNHRHGGAGDDDAGMTTLEMAPMQEAVGYGDGPA HQMMQQALDPAGQLMMGGAHQLPPLPCCVFVQETDPSCYSVCNVHGEESGAQGSY</aaseq> |
| Gene Sequence |
<dnaseqindica>116..763#caggggctgaaacaaacccagcacatttgtgtttgtacgcgcagctagctagccacgagcgcggatccatctcctagctagcgcaccatctatggatccataccacgactaaaacatgcatgacccacgcggcttccccatccacccgcagccgtaccacctccaccccacggccggcggcctcggcgagggcaggatgcggggcggcgggcggcggcgccccggcgccaagctctccaccgacccgcagagcgtggcggcgcgggagcggcggcaccggatcagcgaccgcttccgcgtgctccgcagcctcgtgccgggcggcagcaagatggacacggtgtccatgctggagcaggccatccactacgtcaagttcctcaaggcgcaggtcaccctgcaccaggccgcgctcgtgcagcacgaggagggctgccagcacgccgacgtcgccgcggcgttctccgccgccgacgccgatctggcccttgagctgaaccatcgccacggcggcgccggcgatgatgacgccgggatgacgacgctggagatggcgccgatgcaagaggcggtgggctacggcgacggcccggctcatcagatgatgcagcaagcgctcgatccagcggggcagctgatgatgggcggcgctcatcagctgcctcctttgccttgctgtgtcttcgtccaggagactgacccctcgtgctactcggtgtgcaatgtccacggtgaggagtctggtgcgcaaggatcttattagctagctagtgagacagtggcttgcttaggtagttaatttccttaagtatgctcgaatattggctctacccactagctgtctagctctacttagcttacctaggtcgtcaaccaatatattaccggttggtcatggtcccttaaattagctagactcttgatttctgtaagaatgcatatatgcatgcatggggttctgttggagcaatgcataacagagctttgttttacatgcatgcgtgcatgcttcctagatatcattctgaaatctgaacttgtttgctcgatcgcttaattgctatctcaccatttcggt</dnaseqindica> |
| External Link(s) |