Difference between revisions of "Os06g0610300"
Yonglejiang (talk | contribs) (→References) |
|||
| Line 17: | Line 17: | ||
==References== | ==References== | ||
| − | + | ||
| + | <references> | ||
| + | * <ref name="ref1"> | ||
| + | Li X, Qian Q, Fu Z, Wang Y, Xiong G, Zeng D, Wang X, Liu X, Teng S, Hiroshi F et al. Control of tillering in rice[J]. Nature 2003, 422:618-621 | ||
| + | |||
| + | </ref> | ||
| + | * <ref name="ref2"> | ||
| + | Fei Lua,1, Jetty S. S. Ammirajub,1, Abhijit Sanyalc,1, Shengli Zhanga,1,2, Rentao Song, et al. Comparative sequence analysis of MONOCULM1-orthologous regions in 14 Oryza genomes[J]. PNAS. 2009, 106 (6 )2071–2076 | ||
| + | |||
| + | </ref> | ||
| + | * <ref name="ref3"> | ||
| + | Richards, D.E., Peng, J. and Harberd, N.P. Plant GRAS and metazoan STATs: one family?[J]. Bioessays. 2000, 22: 573–577. | ||
==Structured Information== | ==Structured Information== | ||
Revision as of 07:13, 11 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
<references>
Richards, D.E., Peng, J. and Harberd, N.P. Plant GRAS and metazoan STATs: one family?[J]. Bioessays. 2000, 22: 573–577.
Structured Information
| Gene Name |
Os06g0610300 |
|---|---|
| Description |
Conserved hypothetical protein |
| Version |
NM_001064587.1 GI:115468905 GeneID:4341506 |
| Length |
626 bp |
| Definition |
Oryza sativa Japonica Group Os06g0610300, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 6:25189473..25190098 |
| Sequence Coding Region |
25189730..25189909 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008399:25189473..25190098 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008399:25189473..25190098 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgcaatgtgaaacactgacacagctagaccaggtgtggggggtgtgcttgttcttgttgcaaggaagttatctggaggccatcatcaatgaagatcccaccaagggacaaaacatgagatggttggagacttgggtctgtctagtctctattcaaccatttaaagcattgcgtgtgtag</cdnaseq> |
| Protein Sequence |
<aaseq>MQCETLTQLDQVWGVCLFLLQGSYLEAIINEDPTKGQNMRWLET WVCLVSIQPFKALRV</aaseq> |
| Gene Sequence |
<dnaseqindica>258..437#attcactcatgagttaaaattttactcggagttaaattttaactcatgatgacgtaaacgaatctcggacgtccatttctcgatccaatggtagttttcaagttttcactacatatgtggtttgtactgtatattttcccttgcatctccatgtatctcaaaagttacatgagtggcacttgctactgtgcatgtagtatgtgtagcagctaggttataaatttctttatgtgtaacatgtgtgtgatgcatagtatatgcaatgtgaaacactgacacagctagaccaggtgtggggggtgtgcttgttcttgttgcaaggaagttatctggaggccatcatcaatgaagatcccaccaagggacaaaacatgagatggttggagacttgggtctgtctagtctctattcaaccatttaaagcattgcgtgtgtaggctacactcggagagagaacacagagcagccgtccaaaccgtctgaaatgataacttactctaagctagtaggagtgctagtagtaccctctatatgtgcaattttattcgttaaaaaggtttccatgcatgcttttttagtttatcaatagcctaaaccttttgaattattaagagttaattagtccc</dnaseqindica> |
| External Link(s) |
- ↑ Li X, Qian Q, Fu Z, Wang Y, Xiong G, Zeng D, Wang X, Liu X, Teng S, Hiroshi F et al. Control of tillering in rice[J]. Nature 2003, 422:618-621
- ↑ Fei Lua,1, Jetty S. S. Ammirajub,1, Abhijit Sanyalc,1, Shengli Zhanga,1,2, Rentao Song, et al. Comparative sequence analysis of MONOCULM1-orthologous regions in 14 Oryza genomes[J]. PNAS. 2009, 106 (6 )2071–2076