Difference between revisions of "Os06g0212900"

From RiceWiki
Jump to: navigation, search
(References)
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
A killer-protector system was found at the S5 locus encoded by three tightly linked genes [Open Reading Frame 3 (ORF3)to ORF5] regulates fertility in indica japonica hybrids. During female sporogenesis, the action of ORF5+ (killer) and ORF4+ (partner) causes endoplasmic reticulum (ER) stress. ORF3+ (protector) prevents ER stress and produces normal gametes, but ORF3–cannot prevent ER stress, resulting in premature programmed cell death and leads to embryo-sac abortion. Preferential transmission ofORF3+ gametes results in segregation distortion in the progeny. These results add to our understanding of differences betweenindica andjaponica rice and may aid in rice genetic improvement.(Yang, et al. 2012)
+
A killer-protector system was found at the S5 locus encoded by three tightly linked genes [Open Reading Frame 3 (ORF3)to ORF5] regulates fertility in indica japonica hybrids. During female sporogenesis, the action of ORF5+ (killer) and ORF4+ (partner) causes endoplasmic reticulum (ER) stress. ORF3+ (protector) prevents ER stress and produces normal gametes, but ORF3–cannot prevent ER stress, resulting in premature programmed cell death and leads to embryo-sac abortion. Preferential transmission ofORF3+ gametes results in segregation distortion in the progeny. These results add to our understanding of differences betweenindica andjaponica rice and may aid in rice genetic improvement.<ref name="ref1" />
  
 
===Expression===
 
===Expression===

Revision as of 16:25, 11 May 2014

Please input one-sentence summary here.

Annotated Information

Function

A killer-protector system was found at the S5 locus encoded by three tightly linked genes [Open Reading Frame 3 (ORF3)to ORF5] regulates fertility in indica japonica hybrids. During female sporogenesis, the action of ORF5+ (killer) and ORF4+ (partner) causes endoplasmic reticulum (ER) stress. ORF3+ (protector) prevents ER stress and produces normal gametes, but ORF3–cannot prevent ER stress, resulting in premature programmed cell death and leads to embryo-sac abortion. Preferential transmission ofORF3+ gametes results in segregation distortion in the progeny. These results add to our understanding of differences betweenindica andjaponica rice and may aid in rice genetic improvement.[1]

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Jiangyi Yang, Xiaobo Zhao, Ke Cheng, Hongyi Du, Yidan Ouyang, Jiongjiong Chen, Shuqing Qiu, Jianyan Huang, Yunhe Jiang, Liwen Jiang, Jihua Ding, Jia Wang, Caiguo Xu, Xianghua Li, Qifa Zhang. (2012) A Killer-Protector System Regulates Both Hybrid Sterility and Segregation Distortion in Rice. Science, 337: 1336-1340.

Structured Information

Gene Name

Os06g0212900

Description

Heat shock protein Hsp70 family protein

Version

NM_001063661.1 GI:115467053 GeneID:4340470

Length

2022 bp

Definition

Oryza sativa Japonica Group Os06g0212900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:5744189..5746210

Sequence Coding Region

5744384..5744924,5745012..5745469,5745593..5745948,5746038..5746095

Expression

GEO Profiles:Os06g0212900

Genome Context

<gbrowseImage1> name=NC_008399:5744189..5746210 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:5744189..5746210 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggggcgtcgtcgtcttctgttgagcgatctactgctgctgctgctcatcgccatcgcggtggcaggggcagcggcggcgatcgcgatcccaagagcggcgccggcgttcggagttgaaactgggtggccgccggagcactgcttgcgctgcttcgctccaccggatgcccccttcgtcctgggcgccgccgcggccatccatctcggcaacaccaactcctgcatcgccggctacgacgacgacgacgctcccctgggggccaagcgtagctactaccagttctgcatcccctcctgggtagccctcgcacacgacaatggcaccgtcatctccggcgaggccgctatgaaccgcgccgccctcagcccctccacagctgtctccgccttcatgcgcctcctacacagaagggtggaggacgatgtggtgaagagagagatagagcttgtgccgtacaagtttaccaagatgctgggatgggtctccgtccaactagacacagatgctgaattctctgtcgaccatctcgccggcatcctcatctcccacctcaagcacacggcggaggcgcacctgggccgccacatcaacaatgctgtcatcaccctacccagtcgactcagctactccgccgatggcaggcaggtcctcagctcggcggcgaaggagtacagcggcttcagggccgtcaaggtcgtcgacgagcacatcgcggcggccgcggcgtatgggcaccacaccaagcagggtgaccgcaaggccatccttgtcttccatctcggcggccgcacctcccacgcaaccatcttcaagttcgtcgacggcacggctcgcctcatcgcgacgcgagctcatcatttcctcggaggtgacgatttcacggcgaggatcgtggaccacatggtggagcacatcaaggagcagcatggcagggacgtacggcaggaggagaaggcaatggtgaggctaagggtggcgtgcgagcacgccaagaaggcactgagcgagcaacaagagaccctggtgcagatggactcgcttctggacgacggcgcggtcttctccgcgacgctgacgcgggccaagttcgaggagctcaaccacgacctgttggacagagccatggcgctggtgaaggaggtggtggtgacgacgggaggagtggaggtggtggacgaggttcttgtcgtcggcggcagcgcgaggattcccaaggttcgtcagctcgtcaaggactacttcaatggcaacggcaatggcacgcacccaaacagtcgcggttgcaaggggccggtggatgtggaaccagaggatgccgtgcttcatggcgccgcgcttctttcccgtcctctacctgttgcagagggaacagcagcagctcggtccatcggttccgtcggaggcatctga</cdnaseq>

Protein Sequence

<aaseq>MGRRRLLLSDLLLLLLIAIAVAGAAAAIAIPRAAPAFGVETGWP PEHCLRCFAPPDAPFVLGAAAAIHLGNTNSCIAGYDDDDAPLGAKRSYYQFCIPSWVA LAHDNGTVISGEAAMNRAALSPSTAVSAFMRLLHRRVEDDVVKREIELVPYKFTKMLG WVSVQLDTDAEFSVDHLAGILISHLKHTAEAHLGRHINNAVITLPSRLSYSADGRQVL SSAAKEYSGFRAVKVVDEHIAAAAAYGHHTKQGDRKAILVFHLGGRTSHATIFKFVDG TARLIATRAHHFLGGDDFTARIVDHMVEHIKEQHGRDVRQEEKAMVRLRVACEHAKKA LSEQQETLVQMDSLLDDGAVFSATLTRAKFEELNHDLLDRAMALVKEVVVTTGGVEVV DEVLVVGGSARIPKVRQLVKDYFNGNGNGTHPNSRGCKGPVDVEPEDAVLHGAALLSR PLPVAEGTAAARSIGSVGGI</aaseq>

Gene Sequence

<dnaseqindica>1287..1827#742..1199#263..618#116..173#atagtacctgtgggatcgaaaggcactgacgaactcgatcaagaaggagtagtcctatcatataattgctgattcagtgattcgattccgtcgagactcgagagggaggcgaagcatggggcgtcgtcgtcttctgttgagcgatctactgctgctgctgctcatcgccatcggtgagtagactctgccatcggatggacacactagtacttgtaattaattaattaatattttgtctcttgagctttcctcccccttgcagcggtggcaggggcagcggcggcgatcgcgatcccaagagcggcgccggcgttcggagttgaaactgggtggccgccggagcactgcttgcgctgcttcgctccaccggatgcccccttcgtcctgggcgccgccgcggccatccatctcggcaacaccaactcctgcatcgccggctacgacgacgacgacgctcccctgggggccaagcgtagctactaccagttctgcatcccctcctgggtagccctcgcacacgacaatggcaccgtcatctccggcgaggccgctatgaaccgcgccgccctcagcccctccacagctgtctccgccttcatgcgcctcctacacagaaggcaattcccccttccctcccctaaattcgttcttggtttgccagaccaattggggtagtttgtactagtaacaaacatcaaccggttattaatttgctgtgcgtgcccaattttgttaatcagggtggaggacgatgtggtgaagagagagatagagcttgtgccgtacaagtttaccaagatgctgggatgggtctccgtccaactagacacagatgctgaattctctgtcgaccatctcgccggcatcctcatctcccacctcaagcacacggcggaggcgcacctgggccgccacatcaacaatgctgtcatcaccctacccagtcgactcagctactccgccgatggcaggcaggtcctcagctcggcggcgaaggagtacagcggcttcagggccgtcaaggtcgtcgacgagcacatcgcggcggccgcggcgtatgggcaccacaccaagcagggtgaccgcaaggccatccttgtcttccatctcggcggccgcacctcccacgcaaccatcttcaagttcgtcgacggcacggctcgcctcatcgcgacgcgagctcatcatttcctcggaggcaagatcgatcaatgccctgcttctttcttaaatactagtacaaccaattaatttttctttcttttttttttgacatataatgtaggtgacgatttcacggcgaggatcgtggaccacatggtggagcacatcaaggagcagcatggcagggacgtacggcaggaggagaaggcaatggtgaggctaagggtggcgtgcgagcacgccaagaaggcactgagcgagcaacaagagaccctggtgcagatggactcgcttctggacgacggcgcggtcttctccgcgacgctgacgcgggccaagttcgaggagctcaaccacgacctgttggacagagccatggcgctggtgaaggaggtggtggtgacgacgggaggagtggaggtggtggacgaggttcttgtcgtcggcggcagcgcgaggattcccaaggttcgtcagctcgtcaaggactacttcaatggcaacggcaatggcacgcacccaaacagtcgcggttgcaaggggccggtggatgtggaaccagaggatgccgtgcttcatggcgccgcgcttctttcccgtcctctacctgttgcagagggaacagcagcagctcggtccatcggttccgtcggaggcatctgatctctctcgtgtagcttatgctttggctacgacgatgaaccaaggtgggtgcgcttcaggttggagcttacagtgagtgtgggtcattcttgccttctggagtcgttttactagttgtaacatgtagcactaaccactaaataattgttcatttccctgtgaaattctgaatgagacacctccttttgtcaagtc</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0212900, RefSeq:Os06g0212900

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1