Difference between revisions of "Os02g0771400"

From RiceWiki
Jump to: navigation, search
(References)
(References)
 
(17 intermediate revisions by 2 users not shown)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
OsPFA-DSP2 act as negative regulators of the pathogen response in transgenic plants.Ectopic overexpression of OsPFA-DSP2 in rice increased sensitivity to Magnaporthe grisea (M. grisea Z1 strain), inhibited the accumulation of hydrogen peroxide (H2O2) and suppressed the expression of pathogenesis-related (PR) genes after fungal infection.
+
OsPFA-DSP2 act as negative regulators of the pathogen response in transgenic plants.Ectopic overexpression of OsPFA-DSP2 in rice increased sensitivity to Magnaporthe grisea (M. grisea Z1 strain), inhibited the accumulation of hydrogen peroxide (H2O2) and suppressed the expression of pathogenesis-related (PR) genes after fungal infection<ref name="ref1" />.
  
 
===Expression===
 
===Expression===
OsPFA-DSP2 was mainly expressed in calli, seedlings, roots, and young panicles, and localized in cytoplasm and nucleus.
+
OsPFA-DSP2 was mainly expressed in calli, seedlings, roots, and young panicles, and localized in cytoplasm and nucleus<ref name="ref1" />.
  
 
===Evolution===
 
===Evolution===
  
 
AtPFA-DSP4,which is homologous to OsPFA-DSP2,overexpressing in transgenic Arabidopsis plants,also exhibited sensitivity to
 
AtPFA-DSP4,which is homologous to OsPFA-DSP2,overexpressing in transgenic Arabidopsis plants,also exhibited sensitivity to
Pseudomonas syringae pv. tomato DC3000 (Pst DC3000), reduced accumulation of H2O2 and decreased photosynthesic capacity after infection compared with Col-0.OsPFA-DSP2 and AtPFA-DSP4 act as negative regulators of the pathogen response in transgenic plants.
+
Pseudomonas syringae pv. tomato DC3000 (Pst DC3000), reduced accumulation of H2O2 and decreased photosynthesic capacity after infection compared with Col-0.OsPFA-DSP2 and AtPFA-DSP4 act as negative regulators of the pathogen response in transgenic plants<ref name="ref1" />.
  
 
===Gene Ontology Classification ===
 
===Gene Ontology Classification ===
Line 204: Line 204:
 
==References==
 
==References==
 
<references>
 
<references>
<ref name="ref1">Hanjie He,Jianbin Su,Shengying Shu,Yang Zhang,Ying Ao,Bing Liu,Dongru Feng,Jinfa Wang,Hongbin Wang.
+
<ref name="ref1">Hanjie He,Jianbin Su,Shengying Shu,Yang Zhang,Ying Ao,Bing Liu,Dongru Feng,Jinfa Wang,Hongbin Wang;
   Two Homologous Putative Protein Tyrosine Phosphatases, OsPFA-DSP2 and AtPFA-DSP4, Negatively Regulate the Pathogen Response in Transgenic Plants, PLoS ONE, 2012, 7(4): e34995.</ref>
+
   Two Homologous Putative Protein Tyrosine Phosphatases, OsPFA-DSP2 and AtPFA-DSP4, Negatively Regulate the Pathogen Response in Transgenic Plants, PLoS ONE, 2012, 7(4): e34995</ref>
</references>
 
<references>
 
<ref name="ref1">Jiangyi Yang, Xiaobo Zhao, Ke Cheng, Hongyi Du, Yidan Ouyang, Jiongjiong Chen, Shuqing Qiu, Jianyan Huang, Yunhe Jiang, Liwen Jiang, Jihua Ding, Jia Wang, Caiguo Xu, Xianghua Li, Qifa Zhang. (2012) A Killer-Protector System Regulates Both Hybrid Sterility and Segregation Distortion in Rice. Science 337: 1336-1340.</ref>
 
</references>
 
  
 
==Structured Information==
 
==Structured Information==

Latest revision as of 08:03, 12 May 2014

Protein Tyrosine Phosphatase

Annotated Information

Function

OsPFA-DSP2 act as negative regulators of the pathogen response in transgenic plants.Ectopic overexpression of OsPFA-DSP2 in rice increased sensitivity to Magnaporthe grisea (M. grisea Z1 strain), inhibited the accumulation of hydrogen peroxide (H2O2) and suppressed the expression of pathogenesis-related (PR) genes after fungal infection[1].

Expression

OsPFA-DSP2 was mainly expressed in calli, seedlings, roots, and young panicles, and localized in cytoplasm and nucleus[1].

Evolution

AtPFA-DSP4,which is homologous to OsPFA-DSP2,overexpressing in transgenic Arabidopsis plants,also exhibited sensitivity to Pseudomonas syringae pv. tomato DC3000 (Pst DC3000), reduced accumulation of H2O2 and decreased photosynthesic capacity after infection compared with Col-0.OsPFA-DSP2 and AtPFA-DSP4 act as negative regulators of the pathogen response in transgenic plants[1].

Gene Ontology Classification

GO accession Type Name Code With
GO:0009987[[1]] biological_process cellular process IEA TAIR:AT1G05000
GO:0008152[[2]] biological_process metabolic process IEA TAIR:AT1G05000
GO:0016787 [[3]] molecular_function hydrolase activity IEA TAIR:AT1G05000
GO:0005575[[4]] cellular_component cellular_component IEA TAIR:AT1G05000

PFAM hits

Accession Name Match Start Match End E-value
PF03162.6 [[5]] Y_phosphatase2 46 198 9.8e-63

BlastP Searches (UniRef 100)

Accession  %Sim Length Description P-value
UniRef100_Q0DX67 [[6]] 94.12 204 Os02g0771400 protein n=2 Tax=Oryza sativa RepID=Q0DX67_ORYSJ 4.2e-98
UniRef100_Q0DDQ5 [[7]] 89.44 161 Os06g0208700 protein n=2 Tax=Oryza sativa RepID=Q0DDQ5_ORYSJ 2.2e-69
UniRef100_Q6DL00 [[8]] 89.44 161 Dual-specificity phosphatase protein n=1 Tax=Oryza sativa Re 2.2e-69
UniRef100_A3B9I2[[9]] 89.44 161 Putative uncharacterized protein n=1 Tax=Oryza sativa Japoni 3.6e-69
UniRef100_B6U4B4[[10]] 74.77 214 Tyrosine specific protein phosphatase family protein n=1 Tax 7.5e-69
UniRef100_F2D6J8[[11]] 75.23 214 Predicted protein n=1 Tax=Hordeum vulgare subsp. vulgare Rep 7.5e-69
UniRef100_C4JAD1[[12]] 75.23 214 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C4JA 4.1e-68
UniRef100_B6TUQ6[[13]] 74.65 217 Tyrosine specific protein phosphatase family protein n=1 Tax 2.9e-67
UniRef100_C5XTH0[[14]] 85.29 170 Putative uncharacterized protein Sb04g034500 n=1 Tax=Sorghum 6e-67
UniRef100_B4F971[[15]] 72.22 216 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4F9 3.3e-66
UniRef100_UPI00015CAEE8[[16]] 82.72 162 PREDICTED: hypothetical protein isoform 1 n=1 Tax=Vitis vini 3.2e-61
UniRef100_B6TNL4[[17]] 77.14 175 Tyrosine specific protein phosphatase family protein n=1 Tax 2.9e-60
UniRef100_B9T828[[18]] 86.54 156 Tyrosine-protein phosphatase SIW14, putative n=1 Tax=Ricinus 2.9e-60
UniRef100_Q9ZVN4[[19]] 85.99 157 Probable tyrosine-protein phosphatase At1g05000 n=2 Tax=Arab 5.9e-60
UniRef100_Q6K461[[20]] 84.18 158 Os09g0135700 protein n=2 Tax=Oryza sativa RepID=Q6K461_ORYSJ 9.7e-60
UniRef100_B9IAK7[[21]] 85.35 157 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IAK7_P 1.2e-59
UniRef100_UPI00015CD7AE[[22]] 82.39 159 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID 1.6e-59
UniRef100_B9HZH6[[23]] 84.81 158 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HZH6_P 3.3e-59
UniRef100_B4FLL8[[24]] 82.5 160 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FL 8.7e-59
UniRef100_B9N8H3[[25]] 84.81 158 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N8H3_P 8.7e-59

Labs working on this gene

  • Key Laboratory of Gene Engineering of Ministry of Education
  • State Key Laboratory of Biocontrol and Guangdong Key Laboratory of Plant Resources
  • School of Life Sciences,Sun Yat-sen University, Guangzhou, People’s Republic of China

References

<references> [1]

Structured Information

Gene Name

Os02g0771400

Description

Putative tyrosine phosphatase family protein

Version

NM_001054792.2 GI:297599967 GeneID:4330871

Length

3886 bp

Definition

Oryza sativa Japonica Group Os02g0771400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:33425073..33428958

Sequence Coding Region

33425223..33425396,33425500..33425543,33425630..33425687,33428497..33428590,33428703..33428947

Expression

GEO Profiles:Os02g0771400

Genome Context

<gbrowseImage1> name=NC_008395:33425073..33428958 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:33425073..33428958 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcagctggagatttcgccgagacagaggagccagcagcagaaggaggaggaaggcgagcaccagcagcgcgccggcgaggaggcggtgggcgccgtcttcagcattgagccgtgggtggacgccgcggcggtgctggtgccgccgcttaacttcgccgaggtgaacgacggcatcttccgctccgggttccccgccgccgacaacttcgcgttcctcctctccctcaagctacgctcgatcgtgtacctgtgcccggagccgtacccggaggagaacacgcggtttctggagcagaacggcatcaagcttcaccagttcggtattgacggcagcaaggagctgcttgtaaacatccctgaagaaaaaatccgagaagcactcaaagttattcttgacgtaaggaatcaaccggtgctcatccactgcaagagaggcaagcaccggactggctgcgtcgttgggtgcctgagaaagttgcagaaatggtgcctaacttcagttttcgacgagtaccagcattttgcagcggcgaaggcgagaagtactgatcagagattcatggagctgtttgacacatccagcttgatgcacctgacggcctcacagtgttaa</cdnaseq>

Protein Sequence

<aaseq>MQLEISPRQRSQQQKEEEGEHQQRAGEEAVGAVFSIEPWVDAAA VLVPPLNFAEVNDGIFRSGFPAADNFAFLLSLKLRSIVYLCPEPYPEENTRFLEQNGI KLHQFGIDGSKELLVNIPEEKIREALKVILDVRNQPVLIHCKRGKHRTGCVVGCLRKL QKWCLTSVFDEYQHFAAAKARSTDQRFMELFDTSSLMHLTASQC</aaseq>

Gene Sequence

<dnaseqindica>3563..3736#3416..3459#3272..3329#369..462#12..256#aagaggaggatatgcagctggagatttcgccgagacagaggagccagcagcagaaggaggaggaaggcgagcaccagcagcgcgccggcgaggaggcggtgggcgccgtcttcagcattgagccgtgggtggacgccgcggcggtgctggtgccgccgcttaacttcgccgaggtgaacgacggcatcttccgctccgggttccccgccgccgacaacttcgcgttcctcctctccctcaagctacgctcgatcgtgtgagtcctatacctaggatctctttctcggccacggcgaccgtggcggcgagctcgtcgattacgtgttctgacggcggcggcgacgccttggcgtggttgatcggtgcaggtacctgtgcccggagccgtacccggaggagaacacgcggtttctggagcagaacggcatcaagcttcaccagttcggtattgacggcagcaaggtaaatgaacaagtcaaaaatcatatgcgttgagtcctttgattttctgctttattttccacggatggcaaagtcgatcttcgcatcgaattgttttttggtttttcggtcgatttggtgcgttctgcttgtggagataaataatttgcacacataatttgcaccgagaaatagcaactggtatcgcattacagtggatgcgagggttactttaggtagaacgcgctgtttacctgtttgacatgagcacgcacttgcgttttctgcgcgttgcctcgtgtcgtatggccatgagctcgttcgactactttccgttaaaaaaacatgggaactgacaactgatattgctgcttgcttcggcaaaacacttgggggcaacgcaactagggcaaacaacaactcaactagaacaaacaaaagtccctttcttgctttatctttgcccctttcagttagggcatttgcttgagtctttcaggctgaaaatgtttatcgtttttgggttttgttaacctaaattgacaaggttacgtggtgcatggtgactataaaacaccctgtttgagcaaaatgcatctagtgcgctactatttttatgttcttatttcactaattcgttttcccttctcacaaaatagtgtagaaaatctcattatggtaggagttattttttttacaatgcaaaacaacagtgtcagttaagcgggttcttgcgtcagcccagcacccatagaagattagaagttgtttacaatgctgcaaaagcgtatcttgctactggcctactgccattagcaacagtaaagcttatctttgttatgattattctggtagcgttgtgctacttttctagaagctagttcaaactgattggtagactcatggctaaggaaaatattttctatttcagcatcacgcatttcagggttaggagatttttgtctgcattatgccagtctggttctgagttttactgaatactgcaagctttaagggtaaaaaaaaaaaaagaaaacaccttaagcttaagtgatcagtgatgcagtacagcacaagttctactccctctatcaaaaaaaaaactaatcctaaatttgaatctagaaagacggagggagtagctgagaaatgatgggcttgtggagtctcctctgtgaattgggtgcctaaacaaagatcaagttgacttatgcccattattttttttaagagaacttatgtgaaaaaaaaagaggatcaagttgacttatagtataatcgcacctgtcttttaactgtcgagtgacgtctgaccagcgtaattctttcataaatttgttggccatgactttaattccgttattaaccagccacccaagattaccatttctctgtgtgccatgccatatttattctcattttactagtccttcactgaaagccattagtacggttttgtcaagctgtccatattaaaagttcatttaggcatagacgcatagtagccttggagtatgtcggtatattactccatctcgcaactttagtactcgtgtcatcgcgtggtagcatccaccgcaagtctgcaacaatgagaacatattccactgtcagttctgggttcatgaaggcatgaactgccacggcaaatggtcaaagttggtcagcgtcggcgacttaaggctgaggtcgttgcttgggttaggtattcatccctagttcatgcaaaatgacataactcattaacgtatgattaattaagttttagtttttttaaaaaaataaaattaatatgaatataaaatttaaattaactttcatatagatttcatatagatttttgttaaaaaaaacaccgttcagtaattaaaaaaatgtgcatgtgaaaatcgagtgagttaagttgggaccttcaaacaaaaaaaaactttcatcgttcattggcgattgttgctgtcgatgataaacaacacagatgtgctgaccaactttagcattcccagcaaaaaagaaatatatcgctgagtgaaaagacactgatcaggtggctgaccttactacaagtgtgtgaatggaaattagtgctcactttgacattgtctggagatgatgcttctttttcgccggactcaagctaggtgtctgaaaccactgaattacgagggtcaccggtaataattgtgtcactgctagatggattctaggatggtcactgctagatggattgtacggtggtgtttggatcaaggactaaactttagctcctgtcatatcggatgaatttagagtattaaacatagactacttataaaactaattacataaatgagagctaattcgcgtgacaaaatttttaagcctaattaatccataattagcgcatgtttactgtagcatcacataggctaattatgaattaattaggtttaatagattcgtctcgcgaattagtccggggtcatataataggttttattaatagtctatgtttaatatttataattagtgtccaaacatacgatgtgatatggactaaaaagttttagtcccatctaaacagggtctaagcttgtttctttgttaactagaaccaataatgtagtacatacttgagtggcatgacgatatctttgcatctgaactttcgataaaggtgaaccttatcagttaccgcattagcctgaaactgtgaaacaaattaaaacatccttctattgctataccatatcatcagtaattcagtatgcatccaactgaccattctcttcaatcctgttgactcttaaagttgatgcatagcctgacaataatctgaaccttgctgttacaggagctgcttgtaaacatccctgaagaaaaaatccgagaagcactcaaagttattcttggtatctgcctctacaaagatatatccaatgtctcaaaatttcatcacactatctgtatctaactcttatcgttttgatcaattcagacgtaaggaatcaaccggtgctcatccactgcaagagaggcaaggtagctatatctatttagcattgcacatccctgatatcccattttcttgaaaccttttgctacatgggaattcgacggtttcctgatattccacatgtttcagcaccggactggctgcgtcgttgggtgcctgagaaagttgcagaaatggtgcctaacttcagttttcgacgagtaccagcattttgcagcggcgaaggcgagaagtactgatcagagattcatggagctgtttgacacatccagcttgatgcacctgacggcctcacagtgttaaccgaaccgaatgttttttcatatccggtcccgatctgtaaccatgctgtctacctagcaacatattgtaatgttgctattgaaacaattcatcagagaataatgttagaaccatcattatcctcataaaagtatccatcaaaatacaagg</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0771400, RefSeq:Os02g0771400

  1. 1.0 1.1 1.2 1.3 Hanjie He,Jianbin Su,Shengying Shu,Yang Zhang,Ying Ao,Bing Liu,Dongru Feng,Jinfa Wang,Hongbin Wang; Two Homologous Putative Protein Tyrosine Phosphatases, OsPFA-DSP2 and AtPFA-DSP4, Negatively Regulate the Pathogen Response in Transgenic Plants, PLoS ONE, 2012, 7(4): e34995