Difference between revisions of "Os02g0771400"
(→Labs working on this gene) |
(→References) |
||
| (13 intermediate revisions by 2 users not shown) | |||
| Line 3: | Line 3: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | OsPFA-DSP2 act as negative regulators of the pathogen response in transgenic plants.Ectopic overexpression of OsPFA-DSP2 in rice increased sensitivity to Magnaporthe grisea (M. grisea Z1 strain), inhibited the accumulation of hydrogen peroxide (H2O2) and suppressed the expression of pathogenesis-related (PR) genes after fungal infection. | + | OsPFA-DSP2 act as negative regulators of the pathogen response in transgenic plants.Ectopic overexpression of OsPFA-DSP2 in rice increased sensitivity to Magnaporthe grisea (M. grisea Z1 strain), inhibited the accumulation of hydrogen peroxide (H2O2) and suppressed the expression of pathogenesis-related (PR) genes after fungal infection<ref name="ref1" />. |
===Expression=== | ===Expression=== | ||
| − | OsPFA-DSP2 was mainly expressed in calli, seedlings, roots, and young panicles, and localized in cytoplasm and nucleus. | + | OsPFA-DSP2 was mainly expressed in calli, seedlings, roots, and young panicles, and localized in cytoplasm and nucleus<ref name="ref1" />. |
===Evolution=== | ===Evolution=== | ||
AtPFA-DSP4,which is homologous to OsPFA-DSP2,overexpressing in transgenic Arabidopsis plants,also exhibited sensitivity to | AtPFA-DSP4,which is homologous to OsPFA-DSP2,overexpressing in transgenic Arabidopsis plants,also exhibited sensitivity to | ||
| − | Pseudomonas syringae pv. tomato DC3000 (Pst DC3000), reduced accumulation of H2O2 and decreased photosynthesic capacity after infection compared with Col-0.OsPFA-DSP2 and AtPFA-DSP4 act as negative regulators of the pathogen response in transgenic plants. | + | Pseudomonas syringae pv. tomato DC3000 (Pst DC3000), reduced accumulation of H2O2 and decreased photosynthesic capacity after infection compared with Col-0.OsPFA-DSP2 and AtPFA-DSP4 act as negative regulators of the pathogen response in transgenic plants<ref name="ref1" />. |
===Gene Ontology Classification === | ===Gene Ontology Classification === | ||
| Line 200: | Line 200: | ||
*Key Laboratory of Gene Engineering of Ministry of Education | *Key Laboratory of Gene Engineering of Ministry of Education | ||
*State Key Laboratory of Biocontrol and Guangdong Key Laboratory of Plant Resources | *State Key Laboratory of Biocontrol and Guangdong Key Laboratory of Plant Resources | ||
| + | *School of Life Sciences,Sun Yat-sen University, Guangzhou, People’s Republic of China | ||
==References== | ==References== | ||
<references> | <references> | ||
| − | <ref name="ref1"> | + | <ref name="ref1">Hanjie He,Jianbin Su,Shengying Shu,Yang Zhang,Ying Ao,Bing Liu,Dongru Feng,Jinfa Wang,Hongbin Wang; |
| − | + | Two Homologous Putative Protein Tyrosine Phosphatases, OsPFA-DSP2 and AtPFA-DSP4, Negatively Regulate the Pathogen Response in Transgenic Plants, PLoS ONE, 2012, 7(4): e34995</ref> | |
==Structured Information== | ==Structured Information== | ||
Latest revision as of 08:03, 12 May 2014
Protein Tyrosine Phosphatase
Contents
Annotated Information
Function
OsPFA-DSP2 act as negative regulators of the pathogen response in transgenic plants.Ectopic overexpression of OsPFA-DSP2 in rice increased sensitivity to Magnaporthe grisea (M. grisea Z1 strain), inhibited the accumulation of hydrogen peroxide (H2O2) and suppressed the expression of pathogenesis-related (PR) genes after fungal infection[1].
Expression
OsPFA-DSP2 was mainly expressed in calli, seedlings, roots, and young panicles, and localized in cytoplasm and nucleus[1].
Evolution
AtPFA-DSP4,which is homologous to OsPFA-DSP2,overexpressing in transgenic Arabidopsis plants,also exhibited sensitivity to Pseudomonas syringae pv. tomato DC3000 (Pst DC3000), reduced accumulation of H2O2 and decreased photosynthesic capacity after infection compared with Col-0.OsPFA-DSP2 and AtPFA-DSP4 act as negative regulators of the pathogen response in transgenic plants[1].
Gene Ontology Classification
| GO accession | Type | Name | Code | With |
|---|---|---|---|---|
| GO:0009987[[1]] | biological_process | cellular process | IEA | TAIR:AT1G05000 |
| GO:0008152[[2]] | biological_process | metabolic process | IEA | TAIR:AT1G05000 |
| GO:0016787 [[3]] | molecular_function | hydrolase activity | IEA | TAIR:AT1G05000 |
| GO:0005575[[4]] | cellular_component | cellular_component | IEA | TAIR:AT1G05000 |
PFAM hits
| Accession | Name | Match Start | Match End | E-value |
|---|---|---|---|---|
| PF03162.6 [[5]] | Y_phosphatase2 | 46 | 198 | 9.8e-63 |
BlastP Searches (UniRef 100)
| Accession | %Sim | Length | Description | P-value |
|---|---|---|---|---|
| UniRef100_Q0DX67 [[6]] | 94.12 | 204 | Os02g0771400 protein n=2 Tax=Oryza sativa RepID=Q0DX67_ORYSJ | 4.2e-98 |
| UniRef100_Q0DDQ5 [[7]] | 89.44 | 161 | Os06g0208700 protein n=2 Tax=Oryza sativa RepID=Q0DDQ5_ORYSJ | 2.2e-69 |
| UniRef100_Q6DL00 [[8]] | 89.44 | 161 | Dual-specificity phosphatase protein n=1 Tax=Oryza sativa Re | 2.2e-69 |
| UniRef100_A3B9I2[[9]] | 89.44 | 161 | Putative uncharacterized protein n=1 Tax=Oryza sativa Japoni | 3.6e-69 |
| UniRef100_B6U4B4[[10]] | 74.77 | 214 | Tyrosine specific protein phosphatase family protein n=1 Tax | 7.5e-69 |
| UniRef100_F2D6J8[[11]] | 75.23 | 214 | Predicted protein n=1 Tax=Hordeum vulgare subsp. vulgare Rep | 7.5e-69 |
| UniRef100_C4JAD1[[12]] | 75.23 | 214 | Putative uncharacterized protein n=1 Tax=Zea mays RepID=C4JA | 4.1e-68 |
| UniRef100_B6TUQ6[[13]] | 74.65 | 217 | Tyrosine specific protein phosphatase family protein n=1 Tax | 2.9e-67 |
| UniRef100_C5XTH0[[14]] | 85.29 | 170 | Putative uncharacterized protein Sb04g034500 n=1 Tax=Sorghum | 6e-67 |
| UniRef100_B4F971[[15]] | 72.22 | 216 | Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4F9 | 3.3e-66 |
| UniRef100_UPI00015CAEE8[[16]] | 82.72 | 162 | PREDICTED: hypothetical protein isoform 1 n=1 Tax=Vitis vini | 3.2e-61 |
| UniRef100_B6TNL4[[17]] | 77.14 | 175 | Tyrosine specific protein phosphatase family protein n=1 Tax | 2.9e-60 |
| UniRef100_B9T828[[18]] | 86.54 | 156 | Tyrosine-protein phosphatase SIW14, putative n=1 Tax=Ricinus | 2.9e-60 |
| UniRef100_Q9ZVN4[[19]] | 85.99 | 157 | Probable tyrosine-protein phosphatase At1g05000 n=2 Tax=Arab | 5.9e-60 |
| UniRef100_Q6K461[[20]] | 84.18 | 158 | Os09g0135700 protein n=2 Tax=Oryza sativa RepID=Q6K461_ORYSJ | 9.7e-60 |
| UniRef100_B9IAK7[[21]] | 85.35 | 157 | Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IAK7_P | 1.2e-59 |
| UniRef100_UPI00015CD7AE[[22]] | 82.39 | 159 | PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID | 1.6e-59 |
| UniRef100_B9HZH6[[23]] | 84.81 | 158 | Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HZH6_P | 3.3e-59 |
| UniRef100_B4FLL8[[24]] | 82.5 | 160 | Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FL | 8.7e-59 |
| UniRef100_B9N8H3[[25]] | 84.81 | 158 | Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N8H3_P | 8.7e-59 |
Labs working on this gene
- Key Laboratory of Gene Engineering of Ministry of Education
- State Key Laboratory of Biocontrol and Guangdong Key Laboratory of Plant Resources
- School of Life Sciences,Sun Yat-sen University, Guangzhou, People’s Republic of China
References
<references> [1]
Structured Information
| Gene Name |
Os02g0771400 |
|---|---|
| Description |
Putative tyrosine phosphatase family protein |
| Version |
NM_001054792.2 GI:297599967 GeneID:4330871 |
| Length |
3886 bp |
| Definition |
Oryza sativa Japonica Group Os02g0771400, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 2:33425073..33428958 |
| Sequence Coding Region |
33425223..33425396,33425500..33425543,33425630..33425687,33428497..33428590,33428703..33428947 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008395:33425073..33428958 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008395:33425073..33428958 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgcagctggagatttcgccgagacagaggagccagcagcagaaggaggaggaaggcgagcaccagcagcgcgccggcgaggaggcggtgggcgccgtcttcagcattgagccgtgggtggacgccgcggcggtgctggtgccgccgcttaacttcgccgaggtgaacgacggcatcttccgctccgggttccccgccgccgacaacttcgcgttcctcctctccctcaagctacgctcgatcgtgtacctgtgcccggagccgtacccggaggagaacacgcggtttctggagcagaacggcatcaagcttcaccagttcggtattgacggcagcaaggagctgcttgtaaacatccctgaagaaaaaatccgagaagcactcaaagttattcttgacgtaaggaatcaaccggtgctcatccactgcaagagaggcaagcaccggactggctgcgtcgttgggtgcctgagaaagttgcagaaatggtgcctaacttcagttttcgacgagtaccagcattttgcagcggcgaaggcgagaagtactgatcagagattcatggagctgtttgacacatccagcttgatgcacctgacggcctcacagtgttaa</cdnaseq> |
| Protein Sequence |
<aaseq>MQLEISPRQRSQQQKEEEGEHQQRAGEEAVGAVFSIEPWVDAAA VLVPPLNFAEVNDGIFRSGFPAADNFAFLLSLKLRSIVYLCPEPYPEENTRFLEQNGI KLHQFGIDGSKELLVNIPEEKIREALKVILDVRNQPVLIHCKRGKHRTGCVVGCLRKL QKWCLTSVFDEYQHFAAAKARSTDQRFMELFDTSSLMHLTASQC</aaseq> |
| Gene Sequence |
<dnaseqindica>3563..3736#3416..3459#3272..3329#369..462#12..256#aagaggaggatatgcagctggagatttcgccgagacagaggagccagcagcagaaggaggaggaaggcgagcaccagcagcgcgccggcgaggaggcggtgggcgccgtcttcagcattgagccgtgggtggacgccgcggcggtgctggtgccgccgcttaacttcgccgaggtgaacgacggcatcttccgctccgggttccccgccgccgacaacttcgcgttcctcctctccctcaagctacgctcgatcgtgtgagtcctatacctaggatctctttctcggccacggcgaccgtggcggcgagctcgtcgattacgtgttctgacggcggcggcgacgccttggcgtggttgatcggtgcaggtacctgtgcccggagccgtacccggaggagaacacgcggtttctggagcagaacggcatcaagcttcaccagttcggtattgacggcagcaaggtaaatgaacaagtcaaaaatcatatgcgttgagtcctttgattttctgctttattttccacggatggcaaagtcgatcttcgcatcgaattgttttttggtttttcggtcgatttggtgcgttctgcttgtggagataaataatttgcacacataatttgcaccgagaaatagcaactggtatcgcattacagtggatgcgagggttactttaggtagaacgcgctgtttacctgtttgacatgagcacgcacttgcgttttctgcgcgttgcctcgtgtcgtatggccatgagctcgttcgactactttccgttaaaaaaacatgggaactgacaactgatattgctgcttgcttcggcaaaacacttgggggcaacgcaactagggcaaacaacaactcaactagaacaaacaaaagtccctttcttgctttatctttgcccctttcagttagggcatttgcttgagtctttcaggctgaaaatgtttatcgtttttgggttttgttaacctaaattgacaaggttacgtggtgcatggtgactataaaacaccctgtttgagcaaaatgcatctagtgcgctactatttttatgttcttatttcactaattcgttttcccttctcacaaaatagtgtagaaaatctcattatggtaggagttattttttttacaatgcaaaacaacagtgtcagttaagcgggttcttgcgtcagcccagcacccatagaagattagaagttgtttacaatgctgcaaaagcgtatcttgctactggcctactgccattagcaacagtaaagcttatctttgttatgattattctggtagcgttgtgctacttttctagaagctagttcaaactgattggtagactcatggctaaggaaaatattttctatttcagcatcacgcatttcagggttaggagatttttgtctgcattatgccagtctggttctgagttttactgaatactgcaagctttaagggtaaaaaaaaaaaaagaaaacaccttaagcttaagtgatcagtgatgcagtacagcacaagttctactccctctatcaaaaaaaaaactaatcctaaatttgaatctagaaagacggagggagtagctgagaaatgatgggcttgtggagtctcctctgtgaattgggtgcctaaacaaagatcaagttgacttatgcccattattttttttaagagaacttatgtgaaaaaaaaagaggatcaagttgacttatagtataatcgcacctgtcttttaactgtcgagtgacgtctgaccagcgtaattctttcataaatttgttggccatgactttaattccgttattaaccagccacccaagattaccatttctctgtgtgccatgccatatttattctcattttactagtccttcactgaaagccattagtacggttttgtcaagctgtccatattaaaagttcatttaggcatagacgcatagtagccttggagtatgtcggtatattactccatctcgcaactttagtactcgtgtcatcgcgtggtagcatccaccgcaagtctgcaacaatgagaacatattccactgtcagttctgggttcatgaaggcatgaactgccacggcaaatggtcaaagttggtcagcgtcggcgacttaaggctgaggtcgttgcttgggttaggtattcatccctagttcatgcaaaatgacataactcattaacgtatgattaattaagttttagtttttttaaaaaaataaaattaatatgaatataaaatttaaattaactttcatatagatttcatatagatttttgttaaaaaaaacaccgttcagtaattaaaaaaatgtgcatgtgaaaatcgagtgagttaagttgggaccttcaaacaaaaaaaaactttcatcgttcattggcgattgttgctgtcgatgataaacaacacagatgtgctgaccaactttagcattcccagcaaaaaagaaatatatcgctgagtgaaaagacactgatcaggtggctgaccttactacaagtgtgtgaatggaaattagtgctcactttgacattgtctggagatgatgcttctttttcgccggactcaagctaggtgtctgaaaccactgaattacgagggtcaccggtaataattgtgtcactgctagatggattctaggatggtcactgctagatggattgtacggtggtgtttggatcaaggactaaactttagctcctgtcatatcggatgaatttagagtattaaacatagactacttataaaactaattacataaatgagagctaattcgcgtgacaaaatttttaagcctaattaatccataattagcgcatgtttactgtagcatcacataggctaattatgaattaattaggtttaatagattcgtctcgcgaattagtccggggtcatataataggttttattaatagtctatgtttaatatttataattagtgtccaaacatacgatgtgatatggactaaaaagttttagtcccatctaaacagggtctaagcttgtttctttgttaactagaaccaataatgtagtacatacttgagtggcatgacgatatctttgcatctgaactttcgataaaggtgaaccttatcagttaccgcattagcctgaaactgtgaaacaaattaaaacatccttctattgctataccatatcatcagtaattcagtatgcatccaactgaccattctcttcaatcctgttgactcttaaagttgatgcatagcctgacaataatctgaaccttgctgttacaggagctgcttgtaaacatccctgaagaaaaaatccgagaagcactcaaagttattcttggtatctgcctctacaaagatatatccaatgtctcaaaatttcatcacactatctgtatctaactcttatcgttttgatcaattcagacgtaaggaatcaaccggtgctcatccactgcaagagaggcaaggtagctatatctatttagcattgcacatccctgatatcccattttcttgaaaccttttgctacatgggaattcgacggtttcctgatattccacatgtttcagcaccggactggctgcgtcgttgggtgcctgagaaagttgcagaaatggtgcctaacttcagttttcgacgagtaccagcattttgcagcggcgaaggcgagaagtactgatcagagattcatggagctgtttgacacatccagcttgatgcacctgacggcctcacagtgttaaccgaaccgaatgttttttcatatccggtcccgatctgtaaccatgctgtctacctagcaacatattgtaatgttgctattgaaacaattcatcagagaataatgttagaaccatcattatcctcataaaagtatccatcaaaatacaagg</dnaseqindica> |
| External Link(s) |