Difference between revisions of "Os03g0356414"

From RiceWiki
Jump to: navigation, search
(References)
(References)
Line 23: Line 23:
  
 
==References==
 
==References==
1. Ning,Yuese and Jantasuriyarat.The SINA E3 ligase OsDIS1 negatively regulates drought response in rice.Plant physiology.2011,157:242--255
+
1. Ning,Yuese and Jantasuriyarat.The SINA E3 ligase OsDIS1 negatively regulates drought response in rice.Plant physiology.2011,157:242--255;
2. Ning, Yuese and Xie.OsDIS1-mediated stress response pathway in rice.Plant Signal Behav.2011,6:1684--1686
+
2. Ning, Yuese and Xie.OsDIS1-mediated stress response pathway in rice.Plant Signal Behav.2011,6:1684--1686;
3. Yamada, Yasuyuki and Koyama.Basic helix-loop-helix transcription factors and regulation of alkaloid biosynthesis.Plant Signal Behav.2011,6:1627--1630
+
3. Yamada, Yasuyuki and Koyama.Basic helix-loop-helix transcription factors and regulation of alkaloid biosynthesis.Plant Signal Behav.2011,6:1627--1630;
4. Deikman, Jill and Petracek.Drought tolerance through biotechnology: improving translation from the laboratory to farmers’ fields.Current opinion in biotechnology.2012,23:243--250
+
4. Deikman, Jill and Petracek.Drought tolerance through biotechnology: improving translation from the laboratory to farmers’ fields.Current opinion in biotechnology.2012,23:243--250;
5. Lim, Sung Don and Hwang.Comprehensive Analysis of the Rice RING E3 Ligase Family Reveals Their Functional Diversity in Response to Abiotic stress.DNA research.2013,20:299--314
+
5. Lim, Sung Don and Hwang.Comprehensive Analysis of the Rice RING E3 Ligase Family Reveals Their Functional Diversity in Response to Abiotic stress.DNA research.2013,20:299--314;
 
6. Cho, Seok Keun and Ryu.The Arabidopsis RING E3 ubiquitin ligase AtAIRP2 plays combinatory roles with AtAIRP1 in abscisic acid-mediated drought stress responses.Plant physiology.2011,157:2240--2257
 
6. Cho, Seok Keun and Ryu.The Arabidopsis RING E3 ubiquitin ligase AtAIRP2 plays combinatory roles with AtAIRP1 in abscisic acid-mediated drought stress responses.Plant physiology.2011,157:2240--2257
  

Revision as of 01:06, 13 May 2014

Please input one-sentence summary here.

Annotated Information

Function

1. OsDIS1 (for Oryza sativa drought-induced SINA protein 1), a C3HC4 RING finger E3 ligase, is involved in drought-stress signal transduction in rice (O. sativa). 2. OsDIS1 possessed E3 ubiquitin ligase activity and that the conserved region of the RING finger is required for the activity. 3. Overexpression of OsDIS1 reduce drought tolerance in transgenic rice plants, while RNA interference silencing of OsDIS1 enhance drought tolerance. 4. A large number of drought-responsive genes were induced or suppressed in the OsDIS1 overexpression plants under normal and drought conditions. 5. OsDIS1 plays a negative role in drought stress tolerance through transcriptional regulation of diverse stress-related genes and possibly through posttranslational regulation of OsNek6 in rice.

Expression

OsDIS1, a functional E3 ligase, interacts with an E2 (OsUBCx) and few substrates or partners to negatively regulates drought stress tolerance. Specifically, OsDIS1 interacts with a serine/threonine protein kinase OsNek6 and promotes its degradation via the 26S proteasome dependent pathway. In additional, OsDIS1 interacts with the drought and salt positive regulator OsSKIPa in rice.File:OsDIS1.jpg

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

State Laboratory for Biology of Plant Diseases and Insect Pests; Institute of Plant Protection; Chinese Academy of Agricultural Sciences; Beijing, China State Key Laboratory of Plant Genomics; National Center for Plant Gene Research; Institute of Genetics and Developmental Biology; Chinese Academy of Sciences; Beijing, China Hunan Provincial Key Laboratory of Crop Germplasm Innovation and Utilization; Hunan Agricultural University; Changsha Hunan, China; Department of Plant Pathology;Ohio State University; Columbus, OH USA;Department of Applied Plant Sciences Technology, Kangwon National University;Department of Systems Biology, College of Life Science and Biotechnology, Yonsei University,Seoul 120–749,Korea.


References

1. Ning,Yuese and Jantasuriyarat.The SINA E3 ligase OsDIS1 negatively regulates drought response in rice.Plant physiology.2011,157:242--255; 2. Ning, Yuese and Xie.OsDIS1-mediated stress response pathway in rice.Plant Signal Behav.2011,6:1684--1686; 3. Yamada, Yasuyuki and Koyama.Basic helix-loop-helix transcription factors and regulation of alkaloid biosynthesis.Plant Signal Behav.2011,6:1627--1630; 4. Deikman, Jill and Petracek.Drought tolerance through biotechnology: improving translation from the laboratory to farmers’ fields.Current opinion in biotechnology.2012,23:243--250; 5. Lim, Sung Don and Hwang.Comprehensive Analysis of the Rice RING E3 Ligase Family Reveals Their Functional Diversity in Response to Abiotic stress.DNA research.2013,20:299--314; 6. Cho, Seok Keun and Ryu.The Arabidopsis RING E3 ubiquitin ligase AtAIRP2 plays combinatory roles with AtAIRP1 in abscisic acid-mediated drought stress responses.Plant physiology.2011,157:2240--2257

Structured Information

Gene Name

Os03g0356414

Description

Similar to Ubiquitin ligase SINAT5 (EC 6.3.2.-) (Seven in absentia homolog 5). Splice isoform 2

Version

NM_001186491.1 GI:297722112 GeneID:9266295

Length

3760 bp

Definition

Oryza sativa Japonica Group Os03g0356414, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:14184730..14188489

Sequence Coding Region

14185089..14185409,14185874..14186260,14186613..14186810

Expression

GEO Profiles:Os03g0356414

Genome Context

<gbrowseImage1> name=NC_008396:14184730..14188489 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:14184730..14188489 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcctcagttacttatattgatgactccggttctgaggtaattgatcctccaaagactgaggtgctggatgttaccgaacttgctggtgatcctgttccgcattcaccaaaaccaaatgtggtagtttctagcagtgtgcgtgaactgcttgaatgtccagtctgcctgagcgcaatgtatcctcccattcatcagtgctctaatggtcatacattgtgctctggatgcaaaccaagggttcacaatcgctgtccaacttgtaggcatgaactgggtaatattagatgtcttgctctcgagaaggtggctgcgtcgcttgaacttccatgcaagtaccagaacttcgggtgtgtaggcatttatccttactactgcaagctgaagcatgagtcacagtgccaatataggccttatagctgtccatatgctggatctgaatgcacagttgctggtgacattccatacttggtgaatcacttgaaagatgaccacaaggttgacatgcataatggctgcaccttcaaccatcgctatgtcaagtcgaatcctcatgaagttgagaatgccacctggatgcttacggttttcagctgctttggccagtacttctgcctacatttcgaagcatttcagctggggatggcacctgtgtacatcgccttcctgaggttcatgggtgatgacttggaagcaaagaactacagctacagcctggaggtaggaggcactggccgcaaaatgatctggcaaggggttccccggagcatcagagacagccatcggaaggtccgggatagctatgatgggcttatcatccaacggaacatggccttgttcttctctggtggagaaaggaaggagctcaaattgcgggtcactgggagaatttggaaggaacagtga</cdnaseq>

Protein Sequence

<aaseq>MASVTYIDDSGSEVIDPPKTEVLDVTELAGDPVPHSPKPNVVVS SSVRELLECPVCLSAMYPPIHQCSNGHTLCSGCKPRVHNRCPTCRHELGNIRCLALEK VAASLELPCKYQNFGCVGIYPYYCKLKHESQCQYRPYSCPYAGSECTVAGDIPYLVNH LKDDHKVDMHNGCTFNHRYVKSNPHEVENATWMLTVFSCFGQYFCLHFEAFQLGMAPV YIAFLRFMGDDLEAKNYSYSLEVGGTGRKMIWQGVPRSIRDSHRKVRDSYDGLIIQRN MALFFSGGERKELKLRVTGRIWKEQ</aaseq>

Gene Sequence

<dnaseqindica>3081..3401#2230..2616#1680..1877#aaaaaacgcgagaagagagagagagaagcttttaattcgaattctctctctcatcacggcttcttctgcttctccttctcctcccccctcatccctcctccgccggtagccgccggccgggagcgagcagcgagcgagaccggagcccgccggagccggtctcgctcccccctcctcccttgttcgcgccacccccgaggtacatcccgccgatctctctctttctctctctcgttggtctgctctgtgattttttttttttttgccaaggctgttctttatttggcacagagattgttttttttttccttctttgcgggtgtccggttcgagtccacggggtttgactctgccggaaatggttcgaatgcggcggccggagggcggaggaggggttttggggggcgttcttggtgggttggtttgcgccgagtctttgttaatttgttagggttcttgatctgatgcggcttctcgttgccgggatgcgcttgcctcatggctgaattcaaacaggccggtctctctctccctccctctctcccgtcagccgtgtgctttgaccgagtaagtttttgaacttcgattggttgagctgggggttcttgactttttcttactccacgaatgttcctttttgcacaatggggctactaatgaatggaaagctagagatggtgtgcctaatggtgatgtgccgtcattgtgttagctcggatttgtactgcgaatttgcgagctcacatgctcagctgatgatgtgttgatccagggagtatatataattggttggtagagtacttgctagattgtgctcacgggtctcatttcaaagttcagtatgaaatcttggttgtaaagtagtactagtgttttgttaatcgttagggagtacttctcctgcatttttcttaattttttccctttaaaaactgtaggtggatttgttattagtaaagctgatttgtgccaaatagaaattctgttttatccgcagtaaggtactgtaaacagtacttgcaggcactagggtttattggcaaggttttctatgttacattttaataaatgccacctttttcttcgtcaaaagaagccacggttataaagaaaaagtgaagcattaattgatgtaaatgcacgaactacaaatttccacaaatataaaccttttaataaaatccacaaatgaaagaaaaatgcagttcacacaccaatctctttctcaaaatttacacttttcttataacaggtatgctaaattttcttaatacaaagcatatacaaaacatcacaagcactatagacattcatgacatatctgttgcataggacaatatgcagtatgaagacctggctggtcaaaacttccgatgcacatgtgaggccctatccatgtgctttcttgatttctgctcctttatggccctatctccttcaaagcccttaaacacttcaacagtgtccaatcatactatgagactgtatggatatgggcatatggctatacttttgatgaggcaatgattttttttgttaataatagtgttaataggaagtgttgaattggttttttaaaaggaagtatttaagcattgaatttgtcatttattttgactcactaataacacagatagttctctttcctagcaggaccccttacaatatctagtgtatttatggcctcagttacttatattgatgactccggttctgaggtaattgatcctccaaagactgaggtgctggatgttaccgaacttgctggtgatcctgttccgcattcaccaaaaccaaatgtggtagtttctagcagtgtgcgtgaactgcttgaatgtccagtctgcctgagcgcaatgtatcctcccattcatcaggtgcacatataccacttattgaatcttttttgcacttaaaaaggatattttcttgtatggaagtcacttgggaaacaaaatgcgtgtttcatttaattgcattgcttttactatcttgaatcctgctatcatatttgtagtctggcctgatctatttgaacttatctagatgatttcctggtttaaaacggtcgttctgagctgctttttcacatatgttctgttccactaccaaattgttacccatgtatttaagcaccaaaaaagaagttagctaagatagtatgtacaatatgcacattgttgtactatgttgtaagttgtaaccccaactctttttctgctaatgcagtgctctaatggtcatacattgtgctctggatgcaaaccaagggttcacaatcgctgtccaacttgtaggcatgaactgggtaatattagatgtcttgctctcgagaaggtggctgcgtcgcttgaacttccatgcaagtaccagaacttcgggtgtgtaggcatttatccttactactgcaagctgaagcatgagtcacagtgccaatataggccttatagctgtccatatgctggatctgaatgcacagttgctggtgacattccatacttggtgaatcacttgaaagatgaccacaaggttgacatgcataatggctgcaccttcaaccatcgctatgtcaagtcgaatcctcatgaagttgagaatgccacctggatgcttacggtatcccctcgttaactccaccatgttagttattgtgaagtatatcactgatgtttacttatgcaaagattggttcacttgtctgctaagatagtccatatttctgtactgagttttatgagcctttctgtaaaaataaacattggttcacttgtacagtatgattgcactctgtacttttcatgtcaactgaggatgctgatcatgcagcatagttattggtctaaaataatctctcacctatgaagaaactatgcatcagaatatccatctgcttccatttccaaaaaaaaaaaaaaaaactttgtctgctttacagcacaataatagcatttggacagggctcttgatctgcaaccttttcttgctgctttctaagtgcaatataaaattaagaatttccttctaatctgttcttttccattgaacaaaatggactaagtaactataatgcttccatctaggttttcagctgctttggccagtacttctgcctacatttcgaagcatttcagctggggatggcacctgtgtacatcgccttcctgaggttcatgggtgatgacttggaagcaaagaactacagctacagcctggaggtaggaggcactggccgcaaaatgatctggcaaggggttccccggagcatcagagacagccatcggaaggtccgggatagctatgatgggcttatcatccaacggaacatggccttgttcttctctggtggagaaaggaaggagctcaaattgcgggtcactgggagaatttggaaggaacagtgaaaataaaatgtgaaatgatctgttcatcgttcttaacccttgcatgaacctatgtatcatcacagtgcgagaattatagccattcataggcagtgactctaaaatgaagacttgtaatgttattagcttgttttagctaccatcttctgttagattggtgcctgtggatgactagatgacagtcatgtagaccagagtggcactattgtagaattcctggcaaacttctctttgccttgaactgcttgttgagttgccattctgtggtatagggaaatctaatggcaattcatgagatgaatgtgttgaactctttttcatgtttccagcatatttctagcttctttgttcattctttc</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0356414, RefSeq:Os03g0356414