Difference between revisions of "Os04g0624500"

From RiceWiki
Jump to: navigation, search
(Homology)
(Function)
Line 2: Line 2:
  
 
==Annotated Information==
 
==Annotated Information==
===Function===
+
===Function===  
The Phr1 gene  
+
The Phr1 gene control oryza sativa classification. That means the phr1 gene decides Oryza sativa becoming indica rice or japonica rice. Genetically modified function complementary experiments show that oryza sativa are classified to indica rice or japonica rice by Phr1 gene. When the Phr1 gene is knockdown or over expressed in rice, the transgenic rice get different disease-resistant ability. That means the Phr1 gene can regulate plant resistance.
Researchers from indica rice variety 93-11 cloned and identified in the control of indica japonica rice gene and its named PHR1 classification. Genetically modified (gm) function complementary experiments show PHR1 are classified to distinguish indica japonica rice genes. PHR1 inhibit or excessive expression in rice, get different disease-resistant ability of transgenic rice, that can make use of genetic engineering to the genes that regulate plant resistance.
 
  
Asian rice (Oryza sativa) cultivars originated from wild rice and can be divided into two subspecies by several criteria, one of which is the phenol reaction (PHR) phenotype. Grains of indica cultivars turn brown in a phenol solution that accelerates a similar process that occurs during prolonged storage. By contrast, the grains of japonica do not discolor. This distinction may reflect the divergent domestication of these two subspecies. The PHR is controlled by a single gene, Phr1; here, we report the cloning of Phr1, which encodes a polyphenol oxidase. The Phr1 gene is indeed responsible for the PHR
+
Asian rice (Oryza sativa) cultivars originated from wild rice and can be divided into two subspecies by several criteria, one of which is the phenol reaction (PHR) phenotype. Grains of indica cultivars turn brown in a phenol solution that accelerates a similar process that occurs during prolonged storage. By contrast, the grains of japonica do not discolor. This distinction may reflect the divergent domestication of these two subspecies. The PHR is controlled by a single gene, Phr1. The Phr1 encodes a polyphenol oxidase. The Phr1 gene is indeed responsible for the PHR phenotype, as transformation with a functional Phr1 can complement a PHR negative cultivar.
phenotype, as transformation with a functional Phr1 can complement a PHR negative cultivar.
 
  
 
===Expression===
 
===Expression===

Revision as of 13:58, 13 May 2014

Please input one-sentence summary here.

Annotated Information

Function

The Phr1 gene control oryza sativa classification. That means the phr1 gene decides Oryza sativa becoming indica rice or japonica rice. Genetically modified function complementary experiments show that oryza sativa are classified to indica rice or japonica rice by Phr1 gene. When the Phr1 gene is knockdown or over expressed in rice, the transgenic rice get different disease-resistant ability. That means the Phr1 gene can regulate plant resistance.

Asian rice (Oryza sativa) cultivars originated from wild rice and can be divided into two subspecies by several criteria, one of which is the phenol reaction (PHR) phenotype. Grains of indica cultivars turn brown in a phenol solution that accelerates a similar process that occurs during prolonged storage. By contrast, the grains of japonica do not discolor. This distinction may reflect the divergent domestication of these two subspecies. The PHR is controlled by a single gene, Phr1. The Phr1 encodes a polyphenol oxidase. The Phr1 gene is indeed responsible for the PHR phenotype, as transformation with a functional Phr1 can complement a PHR negative cultivar.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.



Homology

The Phr1 gene is highly similar to plant PPO genes (Cary et al., 1992; Chevalier et al., 1999; Constabel et al., 2000; Gooding et al., 2001; Demeke andMorris,2002). The similarity in protein sequence ranges from 43 to 68%, and the highest is found with wheat PPO. In higher plants, PPOs have been proposed to be responsible for the browning of damaged kernels, fruits, or vegetables, which may be response for disease resistance (Nicolas et al., 1994; Thipyapong et al., 1995; Gooding et al., 2001; Demeke and Morris, 2002; Li and Steffens, 2002).

location

The Phr1 gene was mapped to the interval between markers S100 and S115 with genetic distances of 9.3 and 8.5 centimorgan (cM) to Phr1, respectively. The breakpoints can be finely delineated. The Phr1 locus was pinpointed to an 88-kb interval between markers P80 and P168 on a single BAC clone (OSJNBa0053K19).

Labs working on this gene

  • State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China
  • State Key Laboratory of Biocontrol, School of Life Sciences, Zhongshan (Sun Yat-Sen) University, Guangzhou 510275, China
  • State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences,Hangzhou 310006, China
  • National Center for Gene Research, Chinese Academy of Sciences, Shanghai 200002, China
  • Beijing Institute of Genomics, Chinese Academy of Sciences, Beijing 100029, China
  • Department of Ecology and Evolution, University of Chicago, Chicago, Illinois 60637

References

Yanchun Yu,Tian Tang, Qian Qian, YonghongWang,Meixian Yan,Dali Zeng, Bin Han, Chung-IWu,Suhua Shi, and Jiayang Lia,Independent Losses of Function in a Polyphenol Oxidase in Rice: Differentiation in Grain Discoloration between Subspecies and the Role of Positive Selection under Domestication.The Plant Cell, 2008.Vol. 20: 2946–2959,

Structured Information

Gene Name

Os04g0624500

Description

Similar to Polyphenol oxidase (EC 1.10.3.1) (Fragment)

Version

NM_001060467.1 GI:115460663 GeneID:4337055

Length

2464 bp

Definition

Oryza sativa Japonica Group Os04g0624500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:32147679..32150142

Sequence Coding Region

32147695..32148299,32148781..32149039,32149149..32149997

Expression

GEO Profiles:Os04g0624500

Genome Context

<gbrowseImage1> name=NC_008397:32147679..32150142 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:32147679..32150142 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagagcatcaacgtagcaccaggaacaaccgctacgcctcgcatggcgccgccgccgccgccgccgtgcatcaccaacctccagagtacccttcgctacaacaacctgctcttgcaccgcaagacgaaggggtggaagccgcggaacgtgtcctgcagggtcgaccgccgcgacgtgctcctcggcatcagcggcgcggccgccatggtggccacgcagggcggcggcggcgcgctcgcggcgcccatccaggccccggacctcggcgactgccaccagcccgtggacgtccccgccacggcgccggcgatcaactgctgcccgacgtacagcgccggcaccgtcgccgtcgacttcgcgccgccgccggcgtcctcgccgctccgcgtgcggccggcggctcacctggcggacagggcgtacctggccaagtacgagagggccgtgtcgctcatgaagaagctccccgccgacgacccccgcagcttcgagcagcagtggcgcgtccactgcgcctactgcgacggcgcgtacgaccaggtcggcttccccggcttggagatccagatacacagctgctggctcttcttcccatggcacaggatgtacctgtacttccatgagaggatactgggcaagctgatcggcgacgagacgttcgcgctgccgttctggaactgggacgcgccggacggcatgtcgttccccgcgatgtacgccaacaggtggtcgccgctgtacgacccgcggcgcaaccaggctcacctgccaccgttcccgctcgacctcgactacagtggaaccgacacgaacatcccgaaagaccagctgatcgatcagaacctcaacatcatgtaccgccagatgatttcgggagctaggaaggcggagctgttcatggggcagccgtaccgcgccggcgaccagccggagccgggggcgggcaccgtcgagagcgtgccgcacaaccccgtccacagatggaccggcgacccgaggcagccgaacggcgaggacatgggcatcttctactcggcggcgcgcgacccggtgttcttcgcgcaccacggcaacgtcgaccgcatgtggcacatccgccgcggcctcctcttccccggcgacaccgacttcaccgaccccgactggctcgacgccagcttcttcttctacgacgaggaggcccgcctcgtccgcgtccgcgtccgcgacaccctcgacccgtcggcgctgcgcttcacgtaccaggacgtgggtctcccgtggctgaacgccaagccgtccacgggagcagccagcacgccggcgcccgcggccggcgcgttcccggcgaccctggacaagaccgtgcgggtggccgtgacgaggcccagggcgtcgaggagccgcgaggagaaggaggaggaggaggaggtcgagatccccgaccactccacgtacgtcaagttcgacgtgttcgtgaacgcgcccgagagcggggacggcgcggcgacgtgcgcggcgacgtgcgccggcagcgtcgcgctggcgccgcacgggatccaccgcgaggggcagctgtcgccgaggaagacggaggcgaggttcggcatatgcgacttgctggacgacatcggcgccgacggcgacaagacgatcgtcgtgtcgatcgtgccgaggtgtggctgcgattcggtcaccgtcgccggcgtcagcatcggctacgctaagtga</cdnaseq>

Protein Sequence

<aaseq>MESINVAPGTTATPRMAPPPPPPCITNLQSTLRYNNLLLHRKTK GWKPRNVSCRVDRRDVLLGISGAAAMVATQGGGGALAAPIQAPDLGDCHQPVDVPATA PAINCCPTYSAGTVAVDFAPPPASSPLRVRPAAHLADRAYLAKYERAVSLMKKLPADD PRSFEQQWRVHCAYCDGAYDQVGFPGLEIQIHSCWLFFPWHRMYLYFHERILGKLIGD ETFALPFWNWDAPDGMSFPAMYANRWSPLYDPRRNQAHLPPFPLDLDYSGTDTNIPKD QLIDQNLNIMYRQMISGARKAELFMGQPYRAGDQPEPGAGTVESVPHNPVHRWTGDPR QPNGEDMGIFYSAARDPVFFAHHGNVDRMWHIRRGLLFPGDTDFTDPDWLDASFFFYD EEARLVRVRVRDTLDPSALRFTYQDVGLPWLNAKPSTGAASTPAPAAGAFPATLDKTV RVAVTRPRASRSREEKEEEEEVEIPDHSTYVKFDVFVNAPESGDGAATCAATCAGSVA LAPHGIHREGQLSPRKTEARFGICDLLDDIGADGDKTIVVSIVPRCGCDSVTVAGVSI GYAK</aaseq>

Gene Sequence

<dnaseqindica>17..621#1103..1361#1471..2319#acagcgcagtgccgccatggagagcatcaacgtagcaccaggaacaaccgctacgcctcgcatggcgccgccgccgccgccgccgtgcatcaccaacctccagagtacccttcgctacaacaacctgctcttgcaccgcaagacgaaggggtggaagccgcggaacgtgtcctgcagggtcgaccgccgcgacgtgctcctcggcatcagcggcgcggccgccatggtggccacgcagggcggcggcggcgcgctcgcggcgcccatccaggccccggacctcggcgactgccaccagcccgtggacgtccccgccacggcgccggcgatcaactgctgcccgacgtacagcgccggcaccgtcgccgtcgacttcgcgccgccgccggcgtcctcgccgctccgcgtgcggccggcggctcacctggcggacagggcgtacctggccaagtacgagagggccgtgtcgctcatgaagaagctccccgccgacgacccccgcagcttcgagcagcagtggcgcgtccactgcgcctactgcgacggcgcgtacgaccaggtcggcttccccggcttggagatccagatacacagctgctggctcttcttcccatggcacaggtacgtgacattgtgacaacatggctgcatcacgttcacgtctcgcgttgttcgtgtacagttgcatgcatgatatatatggggagtggattttttacgacttcctcttattttgtacatgtcattcaaaaagttatcaaaaaatttaaaaaatttgtcaagatagatcaatatacggtatatctttttcgcaaacatacgagttaaaattcgacttatacaattcgaaacaaaaacaacaaatttgaccgtgatttacgcagttaaatttgttatttttgtttctacttgtataagttgaatttgaatttgtatgtttgtgaaataacatattatatattgatgtaatattgatctatactgctatatttttttaatttttttgatgactttttacttgacatgtaaaaatgagaggattatttgagtggctcatgagattctgtgaacgctggacgcatgcgtgtgaacgtacgtgcaggatgtacctgtacttccatgagaggatactgggcaagctgatcggcgacgagacgttcgcgctgccgttctggaactgggacgcgccggacggcatgtcgttccccgcgatgtacgccaacaggtggtcgccgctgtacgacccgcggcgcaaccaggctcacctgccaccgttcccgctcgacctcgactacagtggaaccgacacgaacatcccgaaagaccagctgatcgatcagaacctcaacatcatgtaccgccaggccagtaatcacatacaaattttgatataaataataatagatgacaaaaactccaaattaatcgacttatgagttaagattggacgaacaaaattttatgatgtttcagatgatttcgggagctaggaaggcggagctgttcatggggcagccgtaccgcgccggcgaccagccggagccgggggcgggcaccgtcgagagcgtgccgcacaaccccgtccacagatggaccggcgacccgaggcagccgaacggcgaggacatgggcatcttctactcggcggcgcgcgacccggtgttcttcgcgcaccacggcaacgtcgaccgcatgtggcacatccgccgcggcctcctcttccccggcgacaccgacttcaccgaccccgactggctcgacgccagcttcttcttctacgacgaggaggcccgcctcgtccgcgtccgcgtccgcgacaccctcgacccgtcggcgctgcgcttcacgtaccaggacgtgggtctcccgtggctgaacgccaagccgtccacgggagcagccagcacgccggcgcccgcggccggcgcgttcccggcgaccctggacaagaccgtgcgggtggccgtgacgaggcccagggcgtcgaggagccgcgaggagaaggaggaggaggaggaggtcgagatccccgaccactccacgtacgtcaagttcgacgtgttcgtgaacgcgcccgagagcggggacggcgcggcgacgtgcgcggcgacgtgcgccggcagcgtcgcgctggcgccgcacgggatccaccgcgaggggcagctgtcgccgaggaagacggaggcgaggttcggcatatgcgacttgctggacgacatcggcgccgacggcgacaagacgatcgtcgtgtcgatcgtgccgaggtgtggctgcgattcggtcaccgtcgccggcgtcagcatcggctacgctaagtgaagcacaacgtgaaccgtggacgtatatttatcatctatacatgtgaacccagatggagagacggatttgtgtttgatatgtgtgtgactaatgattgtatacaaaataatgccagtaatataatgagcatggatgatattggctt</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0624500, RefSeq:Os04g0624500