Difference between revisions of "Os02g0618400"
(→Function) |
|||
| Line 3: | Line 3: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | 1.OsMPS affects plant growth | |
| + | OsMPS is a direct regulator of genes encoding expansins, and it may function as a hub for | ||
| + | multiple hormones to control plant growth. OsMPS overexpression plants were severely reduced in size under control conditions, and we find that seedlings overexpress ing OsMPS was significantly less affected by salt stress than in EV seedings.(Figure4) In a word,in the absence of stress, knockdown of OsMPS increased biomass accumulation, while OsMPS overexpression impaired growth. | ||
| + | 2. OsMPS mis-expression causes metabolic changes related to growth | ||
| + | In OsMPS overexpression plants, a low level of the tricarboxylic acid cycle intermediates | ||
| + | 2–oxoglutarate, malate and fumarate was observed, and these intermediates are directly linked to plant development as their abundance is a potential growth signal. Metabolic profiling revealed that OsMPS over-expression results in accumulation of amino acids and decreased levels of tricarboxylic acid cycle intermediates, which may indicate a lower rate of protein synthesis and metabolism, correlating with the smaller plant size observed. | ||
| + | 3.OsMPS affects heading date and panicle-related traits | ||
| + | OsMPS is expressed in anthers and spikelets, suggesting a role in reproductive development. OE6–2 plants showed a delay in heading and flowering by 21 days, and a reduced number of panicles per plant compared to the EV line.( Figure5) Down-regulation of OsMPScaused early heading and flowering. | ||
| + | 4. OsMPS modulates the expression of hormone and cell wall-related genes | ||
| + | OsMPS negatively regulates the expression of several ARF and IAA genes. Interestingly, the growth inhibition of OsMPS over-expression lines was partially rescued by low concentrations of exogenous auxin. OsMPS acts as a negative regulator of auxin related genes and cell wall-remodeling genes. BR biosynthesis and signaling genes were found to be down-regulated upon over-expression of OsMPS. | ||
===Expression=== | ===Expression=== | ||
Revision as of 11:31, 14 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
1.OsMPS affects plant growth OsMPS is a direct regulator of genes encoding expansins, and it may function as a hub for multiple hormones to control plant growth. OsMPS overexpression plants were severely reduced in size under control conditions, and we find that seedlings overexpress ing OsMPS was significantly less affected by salt stress than in EV seedings.(Figure4) In a word,in the absence of stress, knockdown of OsMPS increased biomass accumulation, while OsMPS overexpression impaired growth. 2. OsMPS mis-expression causes metabolic changes related to growth In OsMPS overexpression plants, a low level of the tricarboxylic acid cycle intermediates 2–oxoglutarate, malate and fumarate was observed, and these intermediates are directly linked to plant development as their abundance is a potential growth signal. Metabolic profiling revealed that OsMPS over-expression results in accumulation of amino acids and decreased levels of tricarboxylic acid cycle intermediates, which may indicate a lower rate of protein synthesis and metabolism, correlating with the smaller plant size observed. 3.OsMPS affects heading date and panicle-related traits OsMPS is expressed in anthers and spikelets, suggesting a role in reproductive development. OE6–2 plants showed a delay in heading and flowering by 21 days, and a reduced number of panicles per plant compared to the EV line.( Figure5) Down-regulation of OsMPScaused early heading and flowering. 4. OsMPS modulates the expression of hormone and cell wall-related genes OsMPS negatively regulates the expression of several ARF and IAA genes. Interestingly, the growth inhibition of OsMPS over-expression lines was partially rescued by low concentrations of exogenous auxin. OsMPS acts as a negative regulator of auxin related genes and cell wall-remodeling genes. BR biosynthesis and signaling genes were found to be down-regulated upon over-expression of OsMPS.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os02g0618400 |
|---|---|
| Description |
Similar to Snapdragon myb protein 305 homolog |
| Version |
NM_001053984.1 GI:115447338 GeneID:4330001 |
| Length |
2071 bp |
| Definition |
Oryza sativa Japonica Group Os02g0618400, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 2:25438318..25440388 |
| Sequence Coding Region |
25438710..25439307,25439416..25439545,25440127..25440268 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008395:25438318..25440388 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008395:25438318..25440388 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggaagggcagcagttcgcttggggaagggaggagggagggtggaggaaagggccatggacagcgcaggaagacaagctgctggttgagtacgtgaggcagcacggcgaagggaggtggaattctgtcgccaagatcacaggtctgaagagaagtggcaagagctgcaggcttcgttgggtgaactacctgagacctgacctcaagcgaggcaagatcacgccacaggaggagagcgtcatactcgagcttcatgccttgtggggaaacaggtggtcgacgatcgcgcgtagcctgcctggcaggacggacaacgagatcaagaactactggaggacgcacttcaagaagggcaagccgtccaagaacatcgagcgcgcgagggctcggttcctgaagcagcgccgcgagatgcagcagcagagccagctgatgcaaaccggccagcagcagcagctcggccaagacgacgacgccaccagcgcggtggtggacgacaaccttgcggaggtcgcgccaccagccgccacctcgctgacccacgacggcgagctccagataatgcaggagatggcgccggacatggacgacctgctgtactaccacccgggagacatgtcgccctattcctacgacgacctcctcggcagcggcggcggcgagtgcggcgccgtggcggccagcgctggcgctgccgcctcgacgagcgagggctcaagcgaggagctcgacggcggcgccgccacgtggggcagcctgtggaacctcgacgacgtggtgcacgacatgatgatcgactgcgccgccggcgccggctgctgctggggtagcttccctccgctacaggataaaggcctcgctttctactag</cdnaseq> |
| Protein Sequence |
<aaseq>MEGQQFAWGREEGGWRKGPWTAQEDKLLVEYVRQHGEGRWNSVA KITGLKRSGKSCRLRWVNYLRPDLKRGKITPQEESVILELHALWGNRWSTIARSLPGR TDNEIKNYWRTHFKKGKPSKNIERARARFLKQRREMQQQSQLMQTGQQQQLGQDDDAT SAVVDDNLAEVAPPAATSLTHDGELQIMQEMAPDMDDLLYYHPGDMSPYSYDDLLGSG GGECGAVAASAGAAASTSEGSSEELDGGAATWGSLWNLDDVVHDMMIDCAAGAGCCWG SFPPLQDKGLAFY</aaseq> |
| Gene Sequence |
<dnaseqindica>1082..1679#844..973#121..262#atcgatcgcttcatcactcgctagctcatcactgcgagcggagacagctcaggagggaggaagcaaaagaagagagagagagatcaagagatagacgaagagatttgtctgtgtaaatcaatggaagggcagcagttcgcttggggaagggaggagggagggtggaggaaagggccatggacagcgcaggaagacaagctgctggttgagtacgtgaggcagcacggcgaagggaggtggaattctgtcgccaagatcacaggtaggtgctatagctactgattgagtggtgttcttgcatgttcgtgaccatttcgatgttctctcgcacgttgtcccaaatcaagaagctcgatatatatagccttttaggaagaaattatagctagtagcatcagtttgcatttggtttgttaaattgcacgttggggcagtcaaacatgcaattagtacatgtttaaggttgcatatgtcgcccatgattgtcaagttgcatgatttgattccaattgcggcatttggtacgatcgtgttttcggagaataggcatttggtgcttgctctagcacatgcattaattaattaaaccgcgtatgaactgcatgcacgcgcgtgtaaattcgtcagaaccttttcctagctgtaaccgtggaaatccttttcctagctgagagttagcttcagatgattagcattaaccaagctttactttcttagttaagtacaaatgggagtggtaggtgtgtcatgtacatgttactttttctgcatatgtacgtcagctaattctgtctgatgctatgtatcttacagtactgagcctgtgtatgtcgtgctttgcaggtctgaagagaagtggcaagagctgcaggcttcgttgggtgaactacctgagacctgacctcaagcgaggcaagatcacgccacaggaggagagcgtcatactcgagcttcatgccttgtggggaaacaggtaacaacccatttgcaaatcctttcgtgatcgagctcgatcgcgtttaattttgccatgaatgtgtaactgattcgatcgatcgcattattctctgtggcggtgtaggtggtcgacgatcgcgcgtagcctgcctggcaggacggacaacgagatcaagaactactggaggacgcacttcaagaagggcaagccgtccaagaacatcgagcgcgcgagggctcggttcctgaagcagcgccgcgagatgcagcagcagagccagctgatgcaaaccggccagcagcagcagctcggccaagacgacgacgccaccagcgcggtggtggacgacaaccttgcggaggtcgcgccaccagccgccacctcgctgacccacgacggcgagctccagataatgcaggagatggcgccggacatggacgacctgctgtactaccacccgggagacatgtcgccctattcctacgacgacctcctcggcagcggcggcggcgagtgcggcgccgtggcggccagcgctggcgctgccgcctcgacgagcgagggctcaagcgaggagctcgacggcggcgccgccacgtggggcagcctgtggaacctcgacgacgtggtgcacgacatgatgatcgactgcgccgccggcgccggctgctgctggggtagcttccctccgctacaggataaaggcctcgctttctactagctatagcttaacgattactaaattgctagctagctatagctacaagcctacacactctacaagtagatgttccttttggtcttgtgcatcgatccaaactgatagcacacagcagcctgtgcgtgtggaggaggtcacacgtagtgactatgcaggtgagagcgagaggccattttgtgtacacgaagtgttggtggataaggatgcaacaccaactatactccactttgagtagctagctcgcctcgatggcatgtttggctcatttgagagcgctttttctaggagaaaaaggaagggaagagtttttttctttgttttgcttttggagaaagaatataggaggactgcaggggggaaaatcaggtgttaaaagtgcatctgagctcttg</dnaseqindica> |
| External Link(s) |
