Difference between revisions of "Os01g0273800"

From RiceWiki
Jump to: navigation, search
(References)
(Annotated Information)
Line 5: Line 5:
 
IAA(indole-3-acetic acid) is important during starch deposition in addition to its previously suggested role early in grain development. And IAA production in developing rice grains is controlled via expression of OsTAR1,OsYUC9 and OsYUC11. That is to say, OsYUC9, OsYUC11 and OsTAR1 are IAA biosynthesis genes during the rice grain development. The research notes that IAA content increase by 50-fold correlated with a large increase in the expression of OsYUC9 and OsYUC11.
 
IAA(indole-3-acetic acid) is important during starch deposition in addition to its previously suggested role early in grain development. And IAA production in developing rice grains is controlled via expression of OsTAR1,OsYUC9 and OsYUC11. That is to say, OsYUC9, OsYUC11 and OsTAR1 are IAA biosynthesis genes during the rice grain development. The research notes that IAA content increase by 50-fold correlated with a large increase in the expression of OsYUC9 and OsYUC11.
 
In conclusion, Os01g0273800(RAP-DB), OsYUC9, is a kind of IAA biosynthesis gene. OsYUC9 and its encoded enzymes may have a role in the starch deposition phase in rice grains.
 
In conclusion, Os01g0273800(RAP-DB), OsYUC9, is a kind of IAA biosynthesis gene. OsYUC9 and its encoded enzymes may have a role in the starch deposition phase in rice grains.
 
  
 
===Gene type===
 
===Gene type===
protein codin
+
protein coding
 
 
  
 
===General protein information===
 
===General protein information===
 
Names:hypothetical protein
 
Names:hypothetical protein
 
 
----
 
----
 
FAD dependent oxidoreductase family protein~contains InterPro domain(s): IPR013027, IPR000103, IPR000960, IPR006076, IPR000205~has GO asignment(s): GO:0004497, GO:0006118, GO:0016491~supported by AK109645
 
FAD dependent oxidoreductase family protein~contains InterPro domain(s): IPR013027, IPR000103, IPR000960, IPR006076, IPR000205~has GO asignment(s): GO:0004497, GO:0006118, GO:0016491~supported by AK109645
 
 
----
 
----
 
 
  
 
===Expression===
 
===Expression===
 
The expression of OsYUC9 is localized primarily in the endosperm. In the developing grains, OsYUC9 is co-expressed with OsTAR1 both temporally and spatially.
 
The expression of OsYUC9 is localized primarily in the endosperm. In the developing grains, OsYUC9 is co-expressed with OsTAR1 both temporally and spatially.
 
  
 
===Evolution===
 
===Evolution===

Revision as of 00:57, 15 May 2014

Please input one-sentence summary here.

Annotated Information

Function

IAA(indole-3-acetic acid) is important during starch deposition in addition to its previously suggested role early in grain development. And IAA production in developing rice grains is controlled via expression of OsTAR1,OsYUC9 and OsYUC11. That is to say, OsYUC9, OsYUC11 and OsTAR1 are IAA biosynthesis genes during the rice grain development. The research notes that IAA content increase by 50-fold correlated with a large increase in the expression of OsYUC9 and OsYUC11. In conclusion, Os01g0273800(RAP-DB), OsYUC9, is a kind of IAA biosynthesis gene. OsYUC9 and its encoded enzymes may have a role in the starch deposition phase in rice grains.

Gene type

protein coding

General protein information

Names:hypothetical protein


FAD dependent oxidoreductase family protein~contains InterPro domain(s): IPR013027, IPR000103, IPR000960, IPR006076, IPR000205~has GO asignment(s): GO:0004497, GO:0006118, GO:0016491~supported by AK109645


Expression

The expression of OsYUC9 is localized primarily in the endosperm. In the developing grains, OsYUC9 is co-expressed with OsTAR1 both temporally and spatially.

Evolution

Yxm.jpg

Labs working on this gene


Molecular and Cellular Biology, University of New England, Armidale, New South Wales, Australia


Department of Biochemistry and Molecular Biology, University of Massachusetts, Amherst, MA 01003,USA


References

Yousef M. Abu-Zaitoon, Karina Benett, Jennifer Normanly and Heather M. Nonhebel, A large increase in IAA during development of rice grains correlates with the expressing of tryptophan aminotransferase OsTAR1 and a grain-specific YUCCA, Physiologia Plantarum 146:487-499.2012


Information from NCBI: [1]

Structured Information

Gene Name

Os01g0273800

Description

FAD dependent oxidoreductase family protein

Version

NM_001049251.1 GI:115435915 GeneID:4325177

Length

5140 bp

Definition

Oryza sativa Japonica Group Os01g0273800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:9487781..9492920

Sequence Coding Region

9487815..9488447,9491586..9491945,9492564..9492767

Expression

GEO Profiles:Os01g0273800

Genome Context

<gbrowseImage1> name=NC_008394:9487781..9492920 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:9487781..9492920 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcggcggtggagcaggatcaggaggaggaggtgatcatcgtcggggcggggccgtcggggctcgcggcggcggcgtgcctgtcggtgcgcggcgtgacgggctgcctcgtcctggagcgcgacgactgcgtggcgtcgctgtggcgccaccgcacctacgaccgcgtccgcctccacctcgccaagcgctactgcgcgctcccgcacgcgccgcacggcgaggcgtcgccgacctacctcccccgcgacgacttcctccgctacctcgacgcctacgcctcccgcttcggcgtccgcgcccgcctccgccgcgaggtccgctcggcgcgctacgacgccgcccgcgcccggtggctcgtcgacgccgtcgacctcgccacgggacgcgcggagcggtacgcggcgaggcacctggtcgccgccgcgggcgagaacgacgagagggtggtgcccgaggtgcccgggatggagacgttccccgggaaggtggtgcacgccgccgactaccggagcgcggaggggttcaaggggaagtccgtgctcgtcgtcggcggcggcaactccggcatggagatcgcctacgacctcgccgtcggcggcgccgccacctccatcgtcatccgcagcgagctgcacctggtgagcaaggagatatggaacttggcgatgacgctgtacaggtacctgccggtgtgggtgatcgacaaggtggtgctgctcatgtgcgccgccgtgttcggcgacaccgcccgctacggcctccggcggccggccgtcgggcccttcaccatgaaggccaccaccacgatgtacccggtcgtggacgtcggcaccttcgccaagatcaggtccggcgagatccgcgtcctcccggccgccatcaagggcgtccgcggccgcgacgtcgagttcgccgacggccagcgccacgccttcgacgccgtcgtcttcgccaccggctaccggagcaccaccaagcactggctcaagagtgatgacgggctgatcggcgacgacgggatggcggggcggagctacccggatcactggaagggggagaacgggctgtactgcgccgggatggtgaggaggggaatctacggcagctacgaggacgcggagcacatcgccgacgacatcagcaagcaactccggagcagcagcaagcctacccacaacaatggctcggcctag</cdnaseq>

Protein Sequence

<aaseq>MAAVEQDQEEEVIIVGAGPSGLAAAACLSVRGVTGCLVLERDDC VASLWRHRTYDRVRLHLAKRYCALPHAPHGEASPTYLPRDDFLRYLDAYASRFGVRAR LRREVRSARYDAARARWLVDAVDLATGRAERYAARHLVAAAGENDERVVPEVPGMETF PGKVVHAADYRSAEGFKGKSVLVVGGGNSGMEIAYDLAVGGAATSIVIRSELHLVSKE IWNLAMTLYRYLPVWVIDKVVLLMCAAVFGDTARYGLRRPAVGPFTMKATTTMYPVVD VGTFAKIRSGEIRVLPAAIKGVRGRDVEFADGQRHAFDAVVFATGYRSTTKHWLKSDD GLIGDDGMAGRSYPDHWKGENGLYCAGMVRRGIYGSYEDAEHIADDISKQLRSSSKPT HNNGSA</aaseq>

Gene Sequence

<dnaseqindica>35..667#3806..4165#4784..4987#acctctctctcgattcaccacggcggcgacggcaatggcggcggtggagcaggatcaggaggaggaggtgatcatcgtcggggcggggccgtcggggctcgcggcggcggcgtgcctgtcggtgcgcggcgtgacgggctgcctcgtcctggagcgcgacgactgcgtggcgtcgctgtggcgccaccgcacctacgaccgcgtccgcctccacctcgccaagcgctactgcgcgctcccgcacgcgccgcacggcgaggcgtcgccgacctacctcccccgcgacgacttcctccgctacctcgacgcctacgcctcccgcttcggcgtccgcgcccgcctccgccgcgaggtccgctcggcgcgctacgacgccgcccgcgcccggtggctcgtcgacgccgtcgacctcgccacgggacgcgcggagcggtacgcggcgaggcacctggtcgccgccgcgggcgagaacgacgagagggtggtgcccgaggtgcccgggatggagacgttccccgggaaggtggtgcacgccgccgactaccggagcgcggaggggttcaaggggaagtccgtgctcgtcgtcggcggcggcaactccggcatggagatcgcctacgacctcgccgtcggcggcgccgccacctccatcgtcatccgcagcgaggtcagctagcttgcttagctcttgtctcctatactagcttaattataattaattcgtttcaatcgtttccaaattaaattcgatttgccattaaaacgagcgaatttcaagctctgtttatttgtccctcgtttaatttgcttataattaattatttttgatttaccaattaattaatcgaatttgtaccttaaaaaaattatacgaccgaatcgaatatttggtactagtataattgttatttgaccaaatttggtagggccgggccaattaataacatcctagccaccttaaaagagctagatttgccaataattttcgtaacattcttattatttgctagtataccaacccctggccccacacgctagtgagaatgagaaaagctattttttttttgtattttctttggtaccaattaatccatggccccacatgccagtgagtgagagtacccgtgcttgatcagttgatcggtgaggaagtaccttgaattaatttacgaccatcggatcgcctaacggacggctaggatcgagtaatcaagctgagtaattaattaaccataattagttactgacagagatcttaaagagggattaattagcagtggacgcggcgggctcctgaccgtgattaagctctgtaattaattaaaaccatccacgttttcttcctttccaatggatcgatcagtacatgtggttattaatcaccagggttaattacttcattactccctagtgttgctggtactacgtagtagtagcgattaattaagacatgacgacgcaacagtccaaattctttcagtgtggtcctaagctaccatcagtactgatgaaacatgacaaatagagaaactccaactaactttgaaatgaaacaaaaaaacacacgtacggagatcgaaattgatccccaaacaccaacattacaggtttacattaatggtctatatgaaaaaaaattaaaaaagagacagagtataatatgccaataaattcggtgaatagaaggtgtgaccacaaataagacgacgtatatttaattaggacatgggacgtatttagaacagaaataaccacacaatctattcaatggtaaaatgtgtacccacgccgctatatatataaggttaattagtccttaatttagtctctttagactgtgctagctagaatataatcatgtacaggtgtttgtaggcgtgagtaattaagtgtgtgcatcctgacgtgtattttgggcaaccaacatgaaagctgtttttttttttaaaacttgggctctttaattccagaggactcgaaagtggaaataaattaaacaattaaaccaacaacctggcagagaatttcgttgctgtatgattaattacagtagtgtgcatgcttattgcaaattttattagacccaaccatataaaatggtatccgagagctatatcgtgggcggcgccatgtaaaagtataaataacttgactatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatattcatcgtcgctggcacatggcctggtctctctcgaactctgacatcacgtgcaggcaaattaaacacatcatcgatcgatcagactacacaatgattttgctcctaattaatctcagccggagaccgcagctgattaaatgcgtaatgtaattcaggtcaggttgcatgcatgcagcataggatccgatgattattttgcttaaaaacatcattaactcgattgttatcaatcacatcacaagcatatatatgtggctcgatccagtatacgtacgttcatctctctgtatgtatgtcgtacgtatatactgtaccgtacgtgcgtcatcgtcatcaggagggaaaaaaacacgttacacgtgcacgcctttgtctgattttcgcatggcgacgccagatccacgcaggcatatcatagtccgtccagcgtccctccggacggcctgggatcctgtcctctagtattttcttgttccaattattaggggagccctctatttgcggctctatttgattcgggctaaatataactatacgtagacagaaagttattcctccctccattctaaaatataagatataactaccattaacccaaaaactaagaaataattattatcgcatcgtagtttagattaccctaataaatagaatacatgcacccaataaaattagagatcttgttgatggaggatttaaataatattattataataaaaaaagatgggctagttaatgacatacatgcatatacgccttatattatgaaataacttgaaacaactttaaaaattagttacgccttatattatggaatggagggagtatatctctacttatttaaatgtagtgtggttatccttcttttttttttccttcttaccgtgtgccaaaagtcgtacggtccttcgtgtgtgcgtaattaccgtaggatctagtttcagagatgtcagtaataatatcattaattaattaaaatttttaatgtaactagtctttgattaatcactatacatctgttggtttagacatcaacacaacgttctataatatccatggaactagcatattgaccgtgcgttgtaacgtgattttaatcaaataaaaaattatcactaagatgttattatcatctcttaattgatgtatatatatttgttactgacatatgaatcctttagtactacactattacttttccttcttataaaaaacatatagttggtgggagtggttgacatataggtcctctagacccacatgccatttttgctaaaaagaaaagttaggagttggtggggggtcggtggcggaacaagaaccaccactactcgagtatagataaacttttttttaaaaaataaaaatataattatatgaaagagctttttatgaaaaatctattaatataaaatttcattttgattttttaaaatattttaatatttagtaatgatttaagatttcgagattttttctacacgcataactgtagtacgtcgtccttactccttagcgaggtaatctcagtgaccattctggttaatcatgcaatctaaattgcaaccaattaattaatcgatcgcagctgcacctggtgagcaaggagatatggaacttggcgatgacgctgtacaggtacctgccggtgtgggtgatcgacaaggtggtgctgctcatgtgcgccgccgtgttcggcgacaccgcccgctacggcctccggcggccggccgtcgggcccttcaccatgaaggccaccaccacgatgtacccggtcgtggacgtcggcaccttcgccaagatcaggtccggcgagatccgcgtcctcccggccgccatcaagggcgtccgcggccgcgacgtcgagttcgccgacggccagcgccacgccttcgacgccgtcgtcttcgccaccggctaccggagcaccaccaagcactggctcaaggtaattgtaattaattaataagttaattaattgaacagtactgtgttaattgtttgcatcatgattcgtacgtgcggcgacacaattaattattgctgctcccggccgtatgcatattcctatttggaaaagtctgaggctttggcatgaagcaaagctcgacaaggtctcaactttcagcagcatacacctcatgctgaacgtacatactgatccgtctcgtaatataaagtattttttgatggatgtgacacatcctaatataatatttgtccagattaattaaatcaggatgtgttacatctatccaaaatcccttatattatgagacgaggtagtacatgtttttcgaataatatatcagcgatagctagtgtggcttatgacaacatttttttttcaatccgaaacacacaaaagctttacatgttatttaaccatcaacaataaaagctctaatatttttgtttttttaaaaaacagaatggcacattaaaaatcatgttttaattaaccttattgtacgatcttaactatgccatatgctagatagtaccttatttatatattttacatatgttttctaacatttgtgtgtaattaaatttaattttatagagtgatgacgggctgatcggcgacgacgggatggcggggcggagctacccggatcactggaagggggagaacgggctgtactgcgccgggatggtgaggaggggaatctacggcagctacgaggacgcggagcacatcgccgacgacatcagcaagcaactccggagcagcagcaagcctacccacaacaatggctcggcctagaaagaaattaaatcaagctgatgaggctctcccccttggaccttgtcttggttattatattaggtgtagcttttatactatgattttgtttctgagtttgtggatgtggatgaaataaacaaaataaaacttgcccttgggtggtctttgatt</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0273800, RefSeq:Os01g0273800