Difference between revisions of "Os05g0486100"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Annotated Information)
Line 4: Line 4:
 
===Function===
 
===Function===
 
This gene encodes a Ca2+-independent Ser/Thr kinase which is induced by auxin and abscisic acid (ABA). The novel leucine-rich-repeat receptor-like kinase affects the root system architecture by negatively regulating polar auxin transport in rice.  
 
This gene encodes a Ca2+-independent Ser/Thr kinase which is induced by auxin and abscisic acid (ABA). The novel leucine-rich-repeat receptor-like kinase affects the root system architecture by negatively regulating polar auxin transport in rice.  
 +
 
[[File:F1.jpg]]
 
[[File:F1.jpg]]
 +
 
Over-expressing VS. Under-expressing
 
Over-expressing VS. Under-expressing
 
Three under-expressing lines:A5, A7, A9
 
Three under-expressing lines:A5, A7, A9
Line 10: Line 12:
 
Three over-expressing lines: O1, O7, O8                                                                                     
 
Three over-expressing lines: O1, O7, O8                                                                                     
  
One week after germination, the growth of the primary embryonic root was delayed in the over-expressing lines, whereas the under-expressing lines had more adventitious root production compared with WT.  At the seedling stage, over-expressing lines exhibited significant shorter shoot height and less fresh weight compared with the WT or under-expressing lines.  From the seedling to the tillering stage, under-expressing lines had an increased tiller number compared with the WT and over-expressing lines.  
+
One week after germination, the growth of the primary embryonic root was delayed in the over-expressing lines, whereas the under-expressing lines had more adventitious root production compared with WT.  At the seedling stage, over-expressing lines exhibited significant shorter shoot height and less fresh weight compared with the WT or under-expressing lines.  From the seedling to the tillering stage, under-expressing lines had an increased tiller number compared with the WT and over-expressing lines.
 +
 
Over-expressing lines had a smaller root system and fewer adventitious roots .  Lateral root formation was severely defective in over-expressing lines.  
 
Over-expressing lines had a smaller root system and fewer adventitious roots .  Lateral root formation was severely defective in over-expressing lines.  
 +
 
Under-expressing lines had well-developed meristems and elongation zones compared with WT, which were slightly defective
 
Under-expressing lines had well-developed meristems and elongation zones compared with WT, which were slightly defective
 
in over-expressing plants.
 
in over-expressing plants.

Revision as of 13:57, 15 May 2014

Please input one-sentence summary here.

Annotated Information

Function

This gene encodes a Ca2+-independent Ser/Thr kinase which is induced by auxin and abscisic acid (ABA). The novel leucine-rich-repeat receptor-like kinase affects the root system architecture by negatively regulating polar auxin transport in rice.

F1.jpg

Over-expressing VS. Under-expressing Three under-expressing lines:A5, A7, A9

Three over-expressing lines: O1, O7, O8

One week after germination, the growth of the primary embryonic root was delayed in the over-expressing lines, whereas the under-expressing lines had more adventitious root production compared with WT. At the seedling stage, over-expressing lines exhibited significant shorter shoot height and less fresh weight compared with the WT or under-expressing lines. From the seedling to the tillering stage, under-expressing lines had an increased tiller number compared with the WT and over-expressing lines.

Over-expressing lines had a smaller root system and fewer adventitious roots . Lateral root formation was severely defective in over-expressing lines.

Under-expressing lines had well-developed meristems and elongation zones compared with WT, which were slightly defective in over-expressing plants.

Expression

This gene is predominantly expressed in root tips, leaf blades, and undifferentiated suspension cells, and is markedly induced by treatment with auxin or ABA.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os05g0486100

Description

Protein kinase-like domain containing protein

Version

NM_001062412.1 GI:115464554 GeneID:4339142

Length

5961 bp

Definition

Oryza sativa Japonica Group Os05g0486100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:23946647..23952607

Sequence Coding Region

23946795..23947319,23947773..23948005,23948130..23948489,23948666..23948824,23949107..23949585
,23949694..23949825,23949911..23949982,23950073..23950147,23950232..23950300
,23950375..23950446,23950546..23950617,23950698..23950769,23950876..23951037
,23951136..23951207,23951305..23951379,23951965..23952036,23952131..23952251
,23952401..23952488

Expression

GEO Profiles:Os05g0486100

Genome Context

<gbrowseImage1> name=NC_008398:23946647..23952607 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:23946647..23952607 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagccgcgggtgttgatggctcttgcgctggtggtggtggcggcgggcgtgccggcggtgttgtgccagaccaacgcccaggacgctgcggcgctcgaggggctgaagagccaatggacgaactacccgttgagctggaactccggcgacccctgcggcggcggatgggacggcatcatgtgcaccaacggcagggtgacgacgctgaggctgtcaagcgtcagcctgcagggaacactgagcagcagcatcggccagctcggccagctcacgtacctggatctttccttcaacatcaatctcggtggtccgctgccagctgagattgggaaccttggggagcttacgacactgatcttagctggttgcagcttcactggaaacattccaatagcaataggcaacctgcggaaacttgggttcttggccttgaattcaaacaagtttagtggtggaataccgtcttcgattggcgtactcacaaacctcttatggctagacctggctgataatcaactcactggatctgtccccatctcaacatcaacatcaccaggcctggaccaacttgtcaaaacgcagcacttccatttcaacaagaaccagttaactggaacgcttactggacttttcaactccaatatgactctcatacacattttgtttgatagcaacaaattctcaggctcaatcccagctgaggttgggactgttagtacactcgaagttctccgattggataggaatggttttacgggagcaatacctgctacaattggcagtttggtcaaactgaatgagctgaacttagcaaacaacaagctaactggatcagtgccagatctcagcaacatgaccaacttgaatgttgtggatttgagcaacaacacatttgatccttcagtggcccccagctggttcacatctttaacatctcttgcttctgtttcaatagtttctggaagtctttctggccaggtcccaaaggggctcttcacattgcccacactgcagcaagttgtgctgagcaacaaccaattcaacgggacacttgaaattacaggcaacatcagcagctcactgcagacagtaaatctcatggacaaccgaatagtttctaccgatactgcaagctacaagaaaactctactcctggcaggtaatccgttttgcgccgagcaagatcccaacaacagagccttctgcagcaggcagctacagaacgcgagcccatacagtaccagtatggaaaaatgcggctcagctcagtgcagtgatggtcagaacgtgaaccctgcaagctgcggctgtgctttctcatacaacggcaagatggttttcagggcacccttcttcgtcgacttggtgagcagtacgccgttccagctgctggagtcgaccatggcggcaaagctgaacctgctccctggctcggtcgctctctcagacatccacttcaacagtgacaactacctccaagttcaagtgaagctgttcccaacatccggggtgaccttcaacctgtcagaattgacaaggattggttcttctctcagtaaccagatttacaaaccaccagcaaattttggaccttatttcttcattgcagacccatatgcccccttggcagttgctcttggtggcaaaaaatccaagatgagcacaggtgccatagctggaattgcagtagccggtggggtccttgttatcgccctcattttcatgtcattgtttgctctccgacagaagagaagggctaaggaactcaaggaaagagcagacccttttgcttcatgggctgctggccagaaggacagtggaggggctccacagctgaagggagcaaggttcttctcctttgacgagctcaagatctgcaccaacaacttctctgacaaccacgagatcgggtcaggaggctacgggaaggtgtacagagggattctcggtgacggaacccgtgtcgccatcaagcgtgcagaccgcaactcaatgcagggcgctgtggagttcaagaacgagatcgagctgctgtccagggtgcaccaccgcaacctggtcagcctcattggcttctgctacgagcaaggtgaacagatgctcgtctacgagtacatctccaatggcacactcagagagaacttgacgggaagtgggatgtacttggactggaagaagaggctgaggatcgcgcttggctcggccagagggcttgcctacctgcacgagctcgctgacccaccgatcatccaccgcgacatcaagtccaccaacatcctcctcgacaacaacctcaaggccaaggttgccgacttcgggctctccaagctcgtggccgacactgagaagggccatgtctccacccaagtcaagggaacactgggctacctggacccggagtactacatgacgcagcagctgtcggagaagagcgacgtgtacagcttcggggtggtgatgctggagctggtgagcgggaggcagccgatcgagaaggggcggtacgtggtgcgggaggtgcggctggccatcgacccggccgaccacgaccaccactacggcctccgcgggatcgtcgacccggccatccgcgacgccgcgcgcaccccggtgttccggcggttcgtgcagctggcgatgcggtgcgtcgacgagtcggcggcggcgcgcccggccatgggcgccgtggtgaaggagatcgaggccatgctgcagaacgagcccgacgacgccggcgccggggagggggacagctccgccgacccgtccgccaacgagttcgaccgccaccgcggcggtggcggcccgccggcgcacccctacagcgacgtggagatcagccggggatcgtacgccggcgatggcgcgtcggattacatgccctattttgaggtcaagcccaagtag</cdnaseq>

Protein Sequence

<aaseq>MEPRVLMALALVVVAAGVPAVLCQTNAQDAAALEGLKSQWTNYP LSWNSGDPCGGGWDGIMCTNGRVTTLRLSSVSLQGTLSSSIGQLGQLTYLDLSFNINL GGPLPAEIGNLGELTTLILAGCSFTGNIPIAIGNLRKLGFLALNSNKFSGGIPSSIGV LTNLLWLDLADNQLTGSVPISTSTSPGLDQLVKTQHFHFNKNQLTGTLTGLFNSNMTL IHILFDSNKFSGSIPAEVGTVSTLEVLRLDRNGFTGAIPATIGSLVKLNELNLANNKL TGSVPDLSNMTNLNVVDLSNNTFDPSVAPSWFTSLTSLASVSIVSGSLSGQVPKGLFT LPTLQQVVLSNNQFNGTLEITGNISSSLQTVNLMDNRIVSTDTASYKKTLLLAGNPFC AEQDPNNRAFCSRQLQNASPYSTSMEKCGSAQCSDGQNVNPASCGCAFSYNGKMVFRA PFFVDLVSSTPFQLLESTMAAKLNLLPGSVALSDIHFNSDNYLQVQVKLFPTSGVTFN LSELTRIGSSLSNQIYKPPANFGPYFFIADPYAPLAVALGGKKSKMSTGAIAGIAVAG GVLVIALIFMSLFALRQKRRAKELKERADPFASWAAGQKDSGGAPQLKGARFFSFDEL KICTNNFSDNHEIGSGGYGKVYRGILGDGTRVAIKRADRNSMQGAVEFKNEIELLSRV HHRNLVSLIGFCYEQGEQMLVYEYISNGTLRENLTGSGMYLDWKKRLRIALGSARGLA YLHELADPPIIHRDIKSTNILLDNNLKAKVADFGLSKLVADTEKGHVSTQVKGTLGYL DPEYYMTQQLSEKSDVYSFGVVMLELVSGRQPIEKGRYVVREVRLAIDPADHDHHYGL RGIVDPAIRDAARTPVFRRFVQLAMRCVDESAAARPAMGAVVKEIEAMLQNEPDDAGA GEGDSSADPSANEFDRHRGGGGPPAHPYSDVEISRGSYAGDGASDYMPYFEVKPK</aaseq>

Gene Sequence

<dnaseqindica>5289..5813#4603..4835#4119..4478#3784..3942#3023..3501#2783..2914#2626..2697#2461..2535#2308..2376#2162..2233#1991..2062#1839..1910#1571..1732#1401..1472#1229..1303#572..643#357..477#120..207#gcgcggactcttctcctcttcttcctccacctcctcctccacgatctccggtcaagcagagcacaagcgtgtgctagctctcccggtggcttgcctcgccggcgacggcgcggcgcaggatggagccgcgggtgttgatggctcttgcgctggtggtggtggcggcgggcgtgccggcggtgttgtgccagaccaacgcccaggacggtgagtgctcttgcctcgccgccggcgatcacctccgtttcttccatagatgattctaaagtcaggcaggatcttcttgcccggagaagaatcgcttggtttttgttgctggtgttgatgatcttcttcttgggcatgcatgcgtgcagctgcggcgctcgaggggctgaagagccaatggacgaactacccgttgagctggaactccggcgacccctgcggcggcggatgggacggcatcatgtgcaccaacggcagggtgacgacgctgtaagttacagccatctccttctcctcctaccaccaatatcatgtgatgggccttcctctgaaatcgtgccatggatgtctctggtttttgcaggaggctgtcaagcgtcagcctgcagggaacactgagcagcagcatcggccagctcggccagctcacgtacctgtaagcaccttcttctatcatcagttcatcacccagcttagcaaaagttcaaaacagcatgattttgcaggctatgaacttgggattttcgaaattttgttcatgcttctgtagcagttcagattgtgaattcaggcaatcaggctaggaacttctgattgaaccagtcaaggggcagattgtcagaacagtttgcttctagtttatgaactctgcttttttttttcttgaggcttagttcagctgaccagttcatgtttaccaatcttaagctttgactatttcggcaatgtgacatggattaggttcatttcttaccaaatgaaagaaacaaagatatgatgccaagttacaatagtaaatagatctggatgaaatatctgaagctttgactattttcgcaatgtgacatggattaggctcatttcttaccaaaagaaagaaacaagatactacacttgaagttaaattatcaatagcaaacgtacctggatgaaatgatccgtgacaaagttctggagtacaactaatttgtctaagaagaaatagtctagtagtagtagctgataacagaaacacttgcagggatctttccttcaacatcaatctcggtggtccgctgccagctgagattgggaaccttggggagcttacgacactgtatgcgccgcactgcccattgttgtcaacactactttttccaatcagaaataccaaactttcttactgatgtgcacaaatgctgtgtaattgtcaggatcttagctggttgcagcttcactggaaacattccaatagcaataggcaacctgcggaaacttgggttcttgtaagtggatatacctggtccacagtttcagatgataaaccctttttttcttttcttttgagtggattgacataatgaattcgtgccattctctatagggccttgaattcaaacaagtttagtggtggaataccgtcttcgattggcgtactcacaaacctcttatggctagacctggctgataatcaactcactggatctgtccccatctcaacatcaacatcaccaggcctggaccaacttgtcaaaacgcagcacttgtaagtaattttaatcttactttatggtattatcaattgagaaatatcagaatatgtaagtacttacaattgattgttttgctccaaacttcaaattgatgaacagccatttcaacaagaaccagttaactggaacgcttactggacttttcaactccaatatgactctcatacacatgtaagggatcgacaaattttcatgtctaatatgaataccgaatagatatatcttgctaacatctctccctatctcgtcagtttgtttgatagcaacaaattctcaggctcaatcccagctgaggttgggactgttagtacactcgaagttctgtaagtatcttgaaagttcacataggtggaactcatccttttattttctccaaaaaaaaaaatggtcatatctttgacttgcttttgtatctttgacagccgattggataggaatggttttacgggagcaatacctgctacaattggcagtttggtcaaactgaatgagctgtaagtgacatctgatcttaaaggaagagttatgacacttgaggcacctctcttgaaaatgttatcttctgcaggaacttagcaaacaacaagctaactggatcagtgccagatctcagcaacatgaccaacttgaatgttgtgtaagaaactaaccacccccatgcctcatcatccaatcatataatttgtctgcataactaaagattccactcttgaattgccagggatttgagcaacaacacatttgatccttcagtggcccccagctggttcacatctttaacatctcttgcttctgtgtgagttatccaaaacttttggaattttaaattttgtgtcgtcttgtgatgacaatttcatactcatctctatatgttttgatcactcagttcaatagtttctggaagtctttctggccaggtcccaaaggggctcttcacattgcccacactgcagcaagtgtaattttctggtaacttacaactcaacatataagctttaaaaaaaagtgtcttatctctgcctattttgtggccaatcggacagtgtgctgagcaacaaccaattcaacgggacacttgaaattacaggcaacatcagcagctcactgcagacagtaaatctcatggacaaccgaatagtttctaccgatactgcaagctacaagaaaactctactgtaagaacctgcaaactcaataagaaccaagaacaccatacaatcttcgtcttctctcctacctttcaccaacattgcctcacttctcatgccatatcctgtctgcagcctggcaggtaatccgttttgcgccgagcaagatcccaacaacagagccttctgcagcaggcagctacagaacgcgagcccatacagtaccagtatggaaaaatgcggctcagctcagtgcagtgatggtcagaacgtgaaccctgcaagctgcggctgtgctttctcatacaacggcaagatggttttcagggcacccttcttcgtcgacttggtgagcagtacgccgttccagctgctggagtcgaccatggcggcaaagctgaacctgctccctggctcggtcgctctctcagacatccacttcaacagtgacaactacctccaagttcaagtgaagctgttcccaacatccggggtgaccttcaacctgtcagaattgacaaggattggttcttctctcagtaaccagatttacaaaccaccagcaaattttggaccttatttcttcattgcagacccatatgcccccttggcaggtacttggatttcactgtgtcgagactcccactttatttgcactgaagtagttttagttttccctttgagaatgcagaggtatcaaaattacagcttaggaaataccacatttcgttatctgagggttggtatcttgaaagttttaattttttacttctaaattgcaattaatgagatgctaaaaggactctgctattttatgtcggagagtttagtatttgcacaaaagtactagtatatagtggtgtgaggattgctcactctgattttgtgtgtgccagttgctcttggtggcaaaaaatccaagatgagcacaggtgccatagctggaattgcagtagccggtggggtccttgttatcgccctcattttcatgtcattgtttgctctccgacagaagagaagggctaaggaactcaaggaaagagcagacccttttggtaaggatctaaaagctcataggtatcatgtcactgcaatgccaccaagcaatttgtcagggacacattaacagctacaagcagcagcatcctactgcatgctactactggaataaactgacaagatcaagaagttctgaaacaactgaacctgttttctgatccaaaattttcagcttcatgggctgctggccagaaggacagtggaggggctccacagctgaagggagcaaggttcttctcctttgacgagctcaagatctgcaccaacaacttctctgacaaccacgagatcgggtcaggaggctacgggaaggtgtacagagggattctcggtgacggaacccgtgtcgccatcaagcgtgcagaccgcaactcaatgcagggcgctgtggagttcaagaacgagatcgagctgctgtccagggtgcaccaccgcaacctggtcagcctcattggcttctgctacgagcaaggtgaacagatgctcgtctacgagtacatctccaatggcacactcagagagaacttgacgggtaaatccacatcccataattaacattgccatgaatctgattacacattttatttcgccatttcgtttgcattgctaaaatgattcttttatcaaatgttaactgaaaaggttttgatttgcaggaagtgggatgtacttggactggaagaagaggctgaggatcgcgcttggctcggccagagggcttgcctacctgcacgagctcgctgacccaccgatcatccaccgcgacatcaagtccaccaacatcctcctcgacaacaacctcaaggccaaggttgccgacttcgggctctccaagctcgtggccgacactgagaagggccatgtctccacccaagtcaagggaacactggtaaattcccctcactatccgctcatgccaatctcctgacagaactgaattttgagcctcacttcagtactcactaataaaaatctactaacatcttgagaaccaatcaaaatcgatatgcttaatttgaaatcaaacttgaagtaaatatggtaactaagcatgtacccattgcacttcaccttactaaccacttctcccaatctcaaaataaatcgataaaattcaccttactaaccacttcttccaatctcatgacaaattgataaaattcaccctactaaccacttctgcaagtctcctgacataactgaacttttaggttcgcttcagtaaaattcgacgaacatcttgaggaccaattgaaatagatatgcttaatttgatctgatagtataaagaaaacaatcaagattgaaacaaatggtaataaaatcgatgggatgtggctagggctacctggacccggagtactacatgacgcagcagctgtcggagaagagcgacgtgtacagcttcggggtggtgatgctggagctggtgagcgggaggcagccgatcgagaaggggcggtacgtggtgcgggaggtgcggctggccatcgacccggccgaccacgaccaccactacggcctccgcgggatcgtcgacccggccatccgcgacgccgcgcgcaccccggtgttccggcggttcgtgcagctggcgatgcggtgcgtcgacgagtcggcggcggcgcgcccggccatgggcgccgtggtgaaggagatcgaggccatgctgcagaacgagcccgacgacgccggcgccggggagggggacagctccgccgacccgtccgccaacgagttcgaccgccaccgcggcggtggcggcccgccggcgcacccctacagcgacgtggagatcagccggggatcgtacgccggcgatggcgcgtcggattacatgccctattttgaggtcaagcccaagtagtcatcattagattgtaaattgatgagggtgttgtttgtttcagtttttttttcctttgttctttctccttttcagcttgtgatgaattgtaaattttgtatgtgttgcgagttgcgacagattaatatatactgctacagattctttc</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0486100, RefSeq:Os05g0486100