Difference between revisions of "Os09g0537700"

From RiceWiki
Jump to: navigation, search
(Evolution)
(Evolution)
Line 9: Line 9:
  
 
===Evolution===
 
===Evolution===
There was not paper about the gene evolution.
+
we cann't find a paper relate to this gene evolution.
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.

Revision as of 00:36, 16 May 2014

Please input one-sentence summary here.

Annotated Information

Function

OsRNS4 is an s-like Rnase gene. It related to the abscisic acid (ABA)-mediated responses and phytochrome-mediated light responses as well as salinity tolerance in rice. Recent study show that OsRNS4-OX lines have enhanced tolerance to high salinity compared to wild type and regulate photosensitivity and abiotic stress responses. OsRNS4 probably acts as a positive regulator in ABA responses in rice seedlings.

Expression

The OsRNS4 gene was expressed at relatively high levels in leaves although its transcripts were detected in various organs. OsRNS4 expression was regulated by salt, PEG and ABA. The seedlings overexpressing OsRNS4 had longer coleoptiles and first leaves than wild-type seedlings under red light and far-red light, suggesting negative regulation of OsRNS4 in photomorphogenesis in rice seedlings. Moreover, ABA-induced growth inhibition of rice seedlings was significantly increased in the OsRNS4-overexpression lines compared with that in wild type.

Evolution

we cann't find a paper relate to this gene evolution.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here. Shandong Natural Science Funds for Distinguished Young Scholars (JQ200911)

the Chinese National Natural Science Foundations (30971744 and 31270232)

the RGRC (Rice Genome Resource Center) in Japan

References

Zheng, J., Wang, Y.Y., He, Y.A., Zhou, J.J., Li, Y.P., Liu, Q.Q., and Xie, X.Z. (2014). Overexpression of an S-like ribonuclease gene, OsRNS4, confers enhanced tolerance to high salinity and hyposensitivity to phytochrome-mediated light signals in rice. Plant Sci 214, 99-105.

Structured Information

Gene Name

Os09g0537700

Description

Ribonuclease T2 family protein

Version

NM_001070328.1 GI:115480398 GeneID:4347708

Length

1983 bp

Definition

Oryza sativa Japonica Group Os09g0537700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 9

Location

Chromosome 9:21987605..21989587

Sequence Coding Region

21987863..21988152,21988266..21988458,21988542..21988703,21989419..21989532

Expression

GEO Profiles:Os09g0537700

Genome Context

<gbrowseImage1> name=NC_008402:21987605..21989587 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008402:21987605..21989587 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagcagaggaaatttttgttgtgcctaattcttggcttacttgcgacttcaggacctgccaagaccgtcaatgctgactcgccctttgatttttattatctcatcctcatgtggcctggagcatactgcactgacagcgagtatggttgttgcgtgcccaagtatggttacccgtcagaagatttcttcgtcaagagcttcatgacctttgactcgtcagagaacacagctgttgtcaggtgcaactccgacaatcctttcgacattaacaagctagactcaatcgagaacaacctgaaccactactggagcaacatcaagtgtcctcgcaccgacggcgtgaactcatggaagagcgagtggaacagctatggcgtctgctccggcctcaaggagttggactacttcaaggccggtctccagctcagaaagaacgcagatgttctctctgctctcgctgaacaaggcatcaagccggactaccaactgtacaacacggcgttcatcaagtgggcagtgaaccagaagctgggtgtgacaccaggagtgcagtgcagggacgggccatttgggaagaagcagttgtacgagatctacctctgcgtcgacaaggacgccaagagcttcatcgactgccctgtcctgcccaacctcagctgccctgccgaggtgctcttccatccgttccacacctggatgctcaacaccacatcggctgccaacatcgtgatgcccactgaaactgtgctggcctaa</cdnaseq>

Protein Sequence

<aaseq>MEQRKFLLCLILGLLATSGPAKTVNADSPFDFYYLILMWPGAYC TDSEYGCCVPKYGYPSEDFFVKSFMTFDSSENTAVVRCNSDNPFDINKLDSIENNLNH YWSNIKCPRTDGVNSWKSEWNSYGVCSGLKELDYFKAGLQLRKNADVLSALAEQGIKP DYQLYNTAFIKWAVNQKLGVTPGVQCRDGPFGKKQLYEIYLCVDKDAKSFIDCPVLPN LSCPAEVLFHPFHTWMLNTTSAANIVMPTETVLA</aaseq>

Gene Sequence

<dnaseqindica>1436..1725#1130..1322#885..1046#56..169#aaccaacaagcaagaagaaatttctctccttgtagaaacaagcctagagagtactatggagcagaggaaatttttgttgtgcctaattcttggcttacttgcgacttcaggacctgccaagaccgtcaatgctgactcgccctttgatttttattatctcatcctcatggtatgaactgcgaatcatcaaatatttaacttcttgcaatgatacgcattaagtttagttataaactatgactacctttttcttatttacactttcttattcaaattaatgaaaaagattctatgtttgtaattcttattagtattacataaaacttctgttcaaggatatgcatgttgtacatgatgtactattggcatctaaccttattattcacgtgaattaagaatttgtaaaattatgaaagtttcctcagaacaagtatatcatctttttttttacaaaatagaaatattaatatcacataaacagcctaaatggacaaattagctgtacgagattttgctactgtcctgtgttcttgctaaaacggaggtcaaagaatgaaagcacgacaaacgagcacatcaacatatttgaacatgcacagcaagcaggagctgcaagacaatatcgacaaaatctactgtgatatatatgacaaaagtctgatgaagtttcaacaatgttgatttagagcatactcatatcaatagtacgtaaaaccagtaaggaaattcaactagaagatatatatctcataggattcaggactcagccccaaacgagggggaaaatttcaaactgaaacgcagagcaaatataaatgatctctagctcaatagctcagcagtttccatggtgagtataaatcgattcgcattcgtgcctgcagtggcctggagcatactgcactgacagcgagtatggttgttgcgtgcccaagtatggttacccgtcagaagatttcttcgtcaagagcttcatgacctttgactcgtcagagaacacagctgttgtcaggtgcaactccgacaatcctttcgacattaacaaggttagcacacattaatttacaagctagcagtctcatttaattagcttcatgtctgtaaatatataattacatgtatattgcagctagactcaatcgagaacaacctgaaccactactggagcaacatcaagtgtcctcgcaccgacggcgtgaactcatggaagagcgagtggaacagctatggcgtctgctccggcctcaaggagttggactacttcaaggccggtctccagctcagaaagaacgcagatgttctctctgctctcgctgaacaaggtacatgtacaaatcataccgacacaccatttagtagtttaaaaaacatacgcgctaatgaaaaccgaggtaaaatctgtgtctgaatgctttttgggccgatggatgaataggcatcaagccggactaccaactgtacaacacggcgttcatcaagtgggcagtgaaccagaagctgggtgtgacaccaggagtgcagtgcagggacgggccatttgggaagaagcagttgtacgagatctacctctgcgtcgacaaggacgccaagagcttcatcgactgccctgtcctgcccaacctcagctgccctgccgaggtgctcttccatccgttccacacctggatgctcaacaccacatcggctgccaacatcgtgatgcccactgaaactgtgctggcctaattaagagcctttaatttgctagctaagctgccatgatctacttgatcaacctgtcctaagagcatgtagcatatgcttagcttgttgctttgggtgaataatcgcgcaacttttatacattgttgtgccctctgaataatatgtgcagtactatatatgaagtattgtaccgcatatgttatgtattacatgtgcaggtcttgtgcacacctgtgaggtgaatggatatattatgaatatataacgtgttgtattatg</dnaseqindica>

External Link(s)

NCBI Gene:Os09g0537700, RefSeq:Os09g0537700