Difference between revisions of "Os05g0486100"

From RiceWiki
Jump to: navigation, search
(Wild Type VS. Mutant)
(Evolution)
Line 26: Line 26:
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
Receptor-like kinases (RLKs) are a family of transmembrane proteins with versatile N-terminal extracellular domains and C-terminal intracellular kinases.Analysis of four fungal, six metazoan, and two Plasmodium sp. genomes indicates that the family was represented in all but fungal genomes, indicating an ancient origin for the family with a more recent expansion only in the plant lineages.
  
You can also add sub-section(s) at will.
+
None of the four fungal genomes examined contained recognizable RLK/Pelle family members. However, the presence of family members in Plasmodium sp. and animal genomes suggests an origin for the RLK/Pelle family in a common ancestor of all genomes examined. The consistently low gene numbers in genomes other than Arabidopsis suggest that a dramatic expansion occurred in the plant lineage. On the other hand, the absence of family members in the fungal genomes examined indicates the RLK/Pelle family may be lost in fungal lineages after fungus-metazoan split.
  
 
==Labs working on this gene==
 
==Labs working on this gene==

Revision as of 06:51, 16 May 2014

Please input one-sentence summary here.

Annotated Information

Fig.1 Top:1-week-old seedlings Bottom: 4-week-old seedlings
Fig.2 Top: Roots of 10-day-old plants Bottom: Roots of 4-week-old plants
Top: Histology of root apex visualized on optical longitudinal sections of living embryonic primary roots Bottom: Longitudinal sections of primary root

Function

This gene encodes a Ca2+-independent Ser/Thr kinase which is induced by auxin and abscisic acid (ABA). The novel leucine-rich-repeat receptor-like kinase affects the root system architecture by negatively regulating polar auxin transport in rice.

Wild Type VS. Mutant

Three under-expressing lines:A5, A7, A9

Three over-expressing lines: O1, O7, O8

One week after germination, the growth of the primary embryonic root was delayed in the over-expressing lines, whereas the under-expressing lines had more adventitious root production compared with WT. At the seedling stage, over-expressing lines exhibited significant shorter shoot height and less fresh weight compared with the WT or under-expressing lines. From the seedling to the tillering stage, under-expressing lines had an increased tiller number compared with the WT and over-expressing lines.(Fig.1)

Over-expressing lines had a smaller root system and fewer adventitious roots . Lateral root formation was severely defective in over-expressing lines. (Fig.2)

Under-expressing lines had well-developed meristems and elongation zones compared with WT, which were slightly defective in over-expressing plants.(Fig.3)

Expression

This gene is predominantly expressed in root tips, leaf blades, and undifferentiated suspension cells, and is markedly induced by treatment with auxin or ABA.

Compared with the roots, the expression of OsRPK1 was reduced 5-fold in the stem and 2-fold in the leaf sheath. Real-time PCR analyses showed that the expression of OsRPK1 was induced mainly by exogenous auxin (2,4-D and IAA) and ABA within 12 h of treatment.

Evolution

Receptor-like kinases (RLKs) are a family of transmembrane proteins with versatile N-terminal extracellular domains and C-terminal intracellular kinases.Analysis of four fungal, six metazoan, and two Plasmodium sp. genomes indicates that the family was represented in all but fungal genomes, indicating an ancient origin for the family with a more recent expansion only in the plant lineages.

None of the four fungal genomes examined contained recognizable RLK/Pelle family members. However, the presence of family members in Plasmodium sp. and animal genomes suggests an origin for the RLK/Pelle family in a common ancestor of all genomes examined. The consistently low gene numbers in genomes other than Arabidopsis suggest that a dramatic expansion occurred in the plant lineage. On the other hand, the absence of family members in the fungal genomes examined indicates the RLK/Pelle family may be lost in fungal lineages after fungus-metazoan split.

Labs working on this gene

Dept. of Biochemistry & Molecular Biology, College of Life Science, Nanjing Agricultural University, Nanjing 210095, China

References

Yu Zou, Xiaoyu Liu, QingWang, Yu Chen, Cheng Liu, Yang Qiu,Wei Zhang, OsRPK1, a novel leucine-rich repeat receptor-like kinase, negatively regulates polar auxin transport and root development in rice, Biochimica et Biophysica Acta 1840 (2014) 1676–1685

Structured Information

Gene Name

Os05g0486100

Description

Protein kinase-like domain containing protein

Version

NM_001062412.1 GI:115464554 GeneID:4339142

Length

5961 bp

Definition

Oryza sativa Japonica Group Os05g0486100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:23946647..23952607

Sequence Coding Region

23946795..23947319,23947773..23948005,23948130..23948489,23948666..23948824,23949107..23949585
,23949694..23949825,23949911..23949982,23950073..23950147,23950232..23950300
,23950375..23950446,23950546..23950617,23950698..23950769,23950876..23951037
,23951136..23951207,23951305..23951379,23951965..23952036,23952131..23952251
,23952401..23952488

Expression

GEO Profiles:Os05g0486100

Genome Context

<gbrowseImage1> name=NC_008398:23946647..23952607 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:23946647..23952607 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagccgcgggtgttgatggctcttgcgctggtggtggtggcggcgggcgtgccggcggtgttgtgccagaccaacgcccaggacgctgcggcgctcgaggggctgaagagccaatggacgaactacccgttgagctggaactccggcgacccctgcggcggcggatgggacggcatcatgtgcaccaacggcagggtgacgacgctgaggctgtcaagcgtcagcctgcagggaacactgagcagcagcatcggccagctcggccagctcacgtacctggatctttccttcaacatcaatctcggtggtccgctgccagctgagattgggaaccttggggagcttacgacactgatcttagctggttgcagcttcactggaaacattccaatagcaataggcaacctgcggaaacttgggttcttggccttgaattcaaacaagtttagtggtggaataccgtcttcgattggcgtactcacaaacctcttatggctagacctggctgataatcaactcactggatctgtccccatctcaacatcaacatcaccaggcctggaccaacttgtcaaaacgcagcacttccatttcaacaagaaccagttaactggaacgcttactggacttttcaactccaatatgactctcatacacattttgtttgatagcaacaaattctcaggctcaatcccagctgaggttgggactgttagtacactcgaagttctccgattggataggaatggttttacgggagcaatacctgctacaattggcagtttggtcaaactgaatgagctgaacttagcaaacaacaagctaactggatcagtgccagatctcagcaacatgaccaacttgaatgttgtggatttgagcaacaacacatttgatccttcagtggcccccagctggttcacatctttaacatctcttgcttctgtttcaatagtttctggaagtctttctggccaggtcccaaaggggctcttcacattgcccacactgcagcaagttgtgctgagcaacaaccaattcaacgggacacttgaaattacaggcaacatcagcagctcactgcagacagtaaatctcatggacaaccgaatagtttctaccgatactgcaagctacaagaaaactctactcctggcaggtaatccgttttgcgccgagcaagatcccaacaacagagccttctgcagcaggcagctacagaacgcgagcccatacagtaccagtatggaaaaatgcggctcagctcagtgcagtgatggtcagaacgtgaaccctgcaagctgcggctgtgctttctcatacaacggcaagatggttttcagggcacccttcttcgtcgacttggtgagcagtacgccgttccagctgctggagtcgaccatggcggcaaagctgaacctgctccctggctcggtcgctctctcagacatccacttcaacagtgacaactacctccaagttcaagtgaagctgttcccaacatccggggtgaccttcaacctgtcagaattgacaaggattggttcttctctcagtaaccagatttacaaaccaccagcaaattttggaccttatttcttcattgcagacccatatgcccccttggcagttgctcttggtggcaaaaaatccaagatgagcacaggtgccatagctggaattgcagtagccggtggggtccttgttatcgccctcattttcatgtcattgtttgctctccgacagaagagaagggctaaggaactcaaggaaagagcagacccttttgcttcatgggctgctggccagaaggacagtggaggggctccacagctgaagggagcaaggttcttctcctttgacgagctcaagatctgcaccaacaacttctctgacaaccacgagatcgggtcaggaggctacgggaaggtgtacagagggattctcggtgacggaacccgtgtcgccatcaagcgtgcagaccgcaactcaatgcagggcgctgtggagttcaagaacgagatcgagctgctgtccagggtgcaccaccgcaacctggtcagcctcattggcttctgctacgagcaaggtgaacagatgctcgtctacgagtacatctccaatggcacactcagagagaacttgacgggaagtgggatgtacttggactggaagaagaggctgaggatcgcgcttggctcggccagagggcttgcctacctgcacgagctcgctgacccaccgatcatccaccgcgacatcaagtccaccaacatcctcctcgacaacaacctcaaggccaaggttgccgacttcgggctctccaagctcgtggccgacactgagaagggccatgtctccacccaagtcaagggaacactgggctacctggacccggagtactacatgacgcagcagctgtcggagaagagcgacgtgtacagcttcggggtggtgatgctggagctggtgagcgggaggcagccgatcgagaaggggcggtacgtggtgcgggaggtgcggctggccatcgacccggccgaccacgaccaccactacggcctccgcgggatcgtcgacccggccatccgcgacgccgcgcgcaccccggtgttccggcggttcgtgcagctggcgatgcggtgcgtcgacgagtcggcggcggcgcgcccggccatgggcgccgtggtgaaggagatcgaggccatgctgcagaacgagcccgacgacgccggcgccggggagggggacagctccgccgacccgtccgccaacgagttcgaccgccaccgcggcggtggcggcccgccggcgcacccctacagcgacgtggagatcagccggggatcgtacgccggcgatggcgcgtcggattacatgccctattttgaggtcaagcccaagtag</cdnaseq>

Protein Sequence

<aaseq>MEPRVLMALALVVVAAGVPAVLCQTNAQDAAALEGLKSQWTNYP LSWNSGDPCGGGWDGIMCTNGRVTTLRLSSVSLQGTLSSSIGQLGQLTYLDLSFNINL GGPLPAEIGNLGELTTLILAGCSFTGNIPIAIGNLRKLGFLALNSNKFSGGIPSSIGV LTNLLWLDLADNQLTGSVPISTSTSPGLDQLVKTQHFHFNKNQLTGTLTGLFNSNMTL IHILFDSNKFSGSIPAEVGTVSTLEVLRLDRNGFTGAIPATIGSLVKLNELNLANNKL TGSVPDLSNMTNLNVVDLSNNTFDPSVAPSWFTSLTSLASVSIVSGSLSGQVPKGLFT LPTLQQVVLSNNQFNGTLEITGNISSSLQTVNLMDNRIVSTDTASYKKTLLLAGNPFC AEQDPNNRAFCSRQLQNASPYSTSMEKCGSAQCSDGQNVNPASCGCAFSYNGKMVFRA PFFVDLVSSTPFQLLESTMAAKLNLLPGSVALSDIHFNSDNYLQVQVKLFPTSGVTFN LSELTRIGSSLSNQIYKPPANFGPYFFIADPYAPLAVALGGKKSKMSTGAIAGIAVAG GVLVIALIFMSLFALRQKRRAKELKERADPFASWAAGQKDSGGAPQLKGARFFSFDEL KICTNNFSDNHEIGSGGYGKVYRGILGDGTRVAIKRADRNSMQGAVEFKNEIELLSRV HHRNLVSLIGFCYEQGEQMLVYEYISNGTLRENLTGSGMYLDWKKRLRIALGSARGLA YLHELADPPIIHRDIKSTNILLDNNLKAKVADFGLSKLVADTEKGHVSTQVKGTLGYL DPEYYMTQQLSEKSDVYSFGVVMLELVSGRQPIEKGRYVVREVRLAIDPADHDHHYGL RGIVDPAIRDAARTPVFRRFVQLAMRCVDESAAARPAMGAVVKEIEAMLQNEPDDAGA GEGDSSADPSANEFDRHRGGGGPPAHPYSDVEISRGSYAGDGASDYMPYFEVKPK</aaseq>

Gene Sequence

<dnaseqindica>5289..5813#4603..4835#4119..4478#3784..3942#3023..3501#2783..2914#2626..2697#2461..2535#2308..2376#2162..2233#1991..2062#1839..1910#1571..1732#1401..1472#1229..1303#572..643#357..477#120..207#gcgcggactcttctcctcttcttcctccacctcctcctccacgatctccggtcaagcagagcacaagcgtgtgctagctctcccggtggcttgcctcgccggcgacggcgcggcgcaggatggagccgcgggtgttgatggctcttgcgctggtggtggtggcggcgggcgtgccggcggtgttgtgccagaccaacgcccaggacggtgagtgctcttgcctcgccgccggcgatcacctccgtttcttccatagatgattctaaagtcaggcaggatcttcttgcccggagaagaatcgcttggtttttgttgctggtgttgatgatcttcttcttgggcatgcatgcgtgcagctgcggcgctcgaggggctgaagagccaatggacgaactacccgttgagctggaactccggcgacccctgcggcggcggatgggacggcatcatgtgcaccaacggcagggtgacgacgctgtaagttacagccatctccttctcctcctaccaccaatatcatgtgatgggccttcctctgaaatcgtgccatggatgtctctggtttttgcaggaggctgtcaagcgtcagcctgcagggaacactgagcagcagcatcggccagctcggccagctcacgtacctgtaagcaccttcttctatcatcagttcatcacccagcttagcaaaagttcaaaacagcatgattttgcaggctatgaacttgggattttcgaaattttgttcatgcttctgtagcagttcagattgtgaattcaggcaatcaggctaggaacttctgattgaaccagtcaaggggcagattgtcagaacagtttgcttctagtttatgaactctgcttttttttttcttgaggcttagttcagctgaccagttcatgtttaccaatcttaagctttgactatttcggcaatgtgacatggattaggttcatttcttaccaaatgaaagaaacaaagatatgatgccaagttacaatagtaaatagatctggatgaaatatctgaagctttgactattttcgcaatgtgacatggattaggctcatttcttaccaaaagaaagaaacaagatactacacttgaagttaaattatcaatagcaaacgtacctggatgaaatgatccgtgacaaagttctggagtacaactaatttgtctaagaagaaatagtctagtagtagtagctgataacagaaacacttgcagggatctttccttcaacatcaatctcggtggtccgctgccagctgagattgggaaccttggggagcttacgacactgtatgcgccgcactgcccattgttgtcaacactactttttccaatcagaaataccaaactttcttactgatgtgcacaaatgctgtgtaattgtcaggatcttagctggttgcagcttcactggaaacattccaatagcaataggcaacctgcggaaacttgggttcttgtaagtggatatacctggtccacagtttcagatgataaaccctttttttcttttcttttgagtggattgacataatgaattcgtgccattctctatagggccttgaattcaaacaagtttagtggtggaataccgtcttcgattggcgtactcacaaacctcttatggctagacctggctgataatcaactcactggatctgtccccatctcaacatcaacatcaccaggcctggaccaacttgtcaaaacgcagcacttgtaagtaattttaatcttactttatggtattatcaattgagaaatatcagaatatgtaagtacttacaattgattgttttgctccaaacttcaaattgatgaacagccatttcaacaagaaccagttaactggaacgcttactggacttttcaactccaatatgactctcatacacatgtaagggatcgacaaattttcatgtctaatatgaataccgaatagatatatcttgctaacatctctccctatctcgtcagtttgtttgatagcaacaaattctcaggctcaatcccagctgaggttgggactgttagtacactcgaagttctgtaagtatcttgaaagttcacataggtggaactcatccttttattttctccaaaaaaaaaaatggtcatatctttgacttgcttttgtatctttgacagccgattggataggaatggttttacgggagcaatacctgctacaattggcagtttggtcaaactgaatgagctgtaagtgacatctgatcttaaaggaagagttatgacacttgaggcacctctcttgaaaatgttatcttctgcaggaacttagcaaacaacaagctaactggatcagtgccagatctcagcaacatgaccaacttgaatgttgtgtaagaaactaaccacccccatgcctcatcatccaatcatataatttgtctgcataactaaagattccactcttgaattgccagggatttgagcaacaacacatttgatccttcagtggcccccagctggttcacatctttaacatctcttgcttctgtgtgagttatccaaaacttttggaattttaaattttgtgtcgtcttgtgatgacaatttcatactcatctctatatgttttgatcactcagttcaatagtttctggaagtctttctggccaggtcccaaaggggctcttcacattgcccacactgcagcaagtgtaattttctggtaacttacaactcaacatataagctttaaaaaaaagtgtcttatctctgcctattttgtggccaatcggacagtgtgctgagcaacaaccaattcaacgggacacttgaaattacaggcaacatcagcagctcactgcagacagtaaatctcatggacaaccgaatagtttctaccgatactgcaagctacaagaaaactctactgtaagaacctgcaaactcaataagaaccaagaacaccatacaatcttcgtcttctctcctacctttcaccaacattgcctcacttctcatgccatatcctgtctgcagcctggcaggtaatccgttttgcgccgagcaagatcccaacaacagagccttctgcagcaggcagctacagaacgcgagcccatacagtaccagtatggaaaaatgcggctcagctcagtgcagtgatggtcagaacgtgaaccctgcaagctgcggctgtgctttctcatacaacggcaagatggttttcagggcacccttcttcgtcgacttggtgagcagtacgccgttccagctgctggagtcgaccatggcggcaaagctgaacctgctccctggctcggtcgctctctcagacatccacttcaacagtgacaactacctccaagttcaagtgaagctgttcccaacatccggggtgaccttcaacctgtcagaattgacaaggattggttcttctctcagtaaccagatttacaaaccaccagcaaattttggaccttatttcttcattgcagacccatatgcccccttggcaggtacttggatttcactgtgtcgagactcccactttatttgcactgaagtagttttagttttccctttgagaatgcagaggtatcaaaattacagcttaggaaataccacatttcgttatctgagggttggtatcttgaaagttttaattttttacttctaaattgcaattaatgagatgctaaaaggactctgctattttatgtcggagagtttagtatttgcacaaaagtactagtatatagtggtgtgaggattgctcactctgattttgtgtgtgccagttgctcttggtggcaaaaaatccaagatgagcacaggtgccatagctggaattgcagtagccggtggggtccttgttatcgccctcattttcatgtcattgtttgctctccgacagaagagaagggctaaggaactcaaggaaagagcagacccttttggtaaggatctaaaagctcataggtatcatgtcactgcaatgccaccaagcaatttgtcagggacacattaacagctacaagcagcagcatcctactgcatgctactactggaataaactgacaagatcaagaagttctgaaacaactgaacctgttttctgatccaaaattttcagcttcatgggctgctggccagaaggacagtggaggggctccacagctgaagggagcaaggttcttctcctttgacgagctcaagatctgcaccaacaacttctctgacaaccacgagatcgggtcaggaggctacgggaaggtgtacagagggattctcggtgacggaacccgtgtcgccatcaagcgtgcagaccgcaactcaatgcagggcgctgtggagttcaagaacgagatcgagctgctgtccagggtgcaccaccgcaacctggtcagcctcattggcttctgctacgagcaaggtgaacagatgctcgtctacgagtacatctccaatggcacactcagagagaacttgacgggtaaatccacatcccataattaacattgccatgaatctgattacacattttatttcgccatttcgtttgcattgctaaaatgattcttttatcaaatgttaactgaaaaggttttgatttgcaggaagtgggatgtacttggactggaagaagaggctgaggatcgcgcttggctcggccagagggcttgcctacctgcacgagctcgctgacccaccgatcatccaccgcgacatcaagtccaccaacatcctcctcgacaacaacctcaaggccaaggttgccgacttcgggctctccaagctcgtggccgacactgagaagggccatgtctccacccaagtcaagggaacactggtaaattcccctcactatccgctcatgccaatctcctgacagaactgaattttgagcctcacttcagtactcactaataaaaatctactaacatcttgagaaccaatcaaaatcgatatgcttaatttgaaatcaaacttgaagtaaatatggtaactaagcatgtacccattgcacttcaccttactaaccacttctcccaatctcaaaataaatcgataaaattcaccttactaaccacttcttccaatctcatgacaaattgataaaattcaccctactaaccacttctgcaagtctcctgacataactgaacttttaggttcgcttcagtaaaattcgacgaacatcttgaggaccaattgaaatagatatgcttaatttgatctgatagtataaagaaaacaatcaagattgaaacaaatggtaataaaatcgatgggatgtggctagggctacctggacccggagtactacatgacgcagcagctgtcggagaagagcgacgtgtacagcttcggggtggtgatgctggagctggtgagcgggaggcagccgatcgagaaggggcggtacgtggtgcgggaggtgcggctggccatcgacccggccgaccacgaccaccactacggcctccgcgggatcgtcgacccggccatccgcgacgccgcgcgcaccccggtgttccggcggttcgtgcagctggcgatgcggtgcgtcgacgagtcggcggcggcgcgcccggccatgggcgccgtggtgaaggagatcgaggccatgctgcagaacgagcccgacgacgccggcgccggggagggggacagctccgccgacccgtccgccaacgagttcgaccgccaccgcggcggtggcggcccgccggcgcacccctacagcgacgtggagatcagccggggatcgtacgccggcgatggcgcgtcggattacatgccctattttgaggtcaagcccaagtagtcatcattagattgtaaattgatgagggtgttgtttgtttcagtttttttttcctttgttctttctccttttcagcttgtgatgaattgtaaattttgtatgtgttgcgagttgcgacagattaatatatactgctacagattctttc</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0486100, RefSeq:Os05g0486100