Difference between revisions of "Os06g0194900"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
In rice three genes encoding for sucrose synthase (Sus) (EC 2.4.1.13) have previously been characterized, and a further three sequences for putative Sus genes reported. The current work confirms that these six genes comprise the entire rice Sus gene family. An expression analysis was conducted in various rice tissues using real-time quantitative RT-PCR. Sus transcripts were detected in a wide range of tissues and at different developmental stages, indicating that Sus is involved in numerous and diverse growth processes in the rice plant. SUS1 was predominantly expressed in elongating tissues including roots, developing leaves and internodes; a potential role for SUS1 in cellulose synthesis is discussed. SUS2 was shown to be expressed in a wide range of tissues, suggesting that it may perform a number of housekeeping role(s). In addition, overall Sus activity and expression of SUS2 increased significantly in seedlings germinated and grown in hypoxia (submerged conditions), suggesting a role in increasing sucrose metabolism as a response to environmental stress. SUS3 and SUS4 were predominantly expressed in the caryopsis, indicating potential roles in carbon allocation within the filling grain. Transcript levels of SUS5 and SUS6 were low in all tissues examined, and were suppressed in germinating shoots under submergence.
+
  In rice three genes encoding for sucrose synthase (Sus) (EC 2.4.1.13) have previously been characterized, and a further three sequences for putative Sus genes reported. The current work confirms that these six genes comprise the entire rice Sus gene family. An expression analysis was conducted in various rice tissues using real-time quantitative RT-PCR. Sus transcripts were detected in a wide range of tissues and at different developmental stages, indicating that Sus is involved in numerous and diverse growth processes in the rice plant. SUS1 was predominantly expressed in elongating tissues including roots, developing leaves and internodes; a potential role for SUS1 in cellulose synthesis is discussed. SUS2 was shown to be expressed in a wide range of tissues, suggesting that it may perform a number of housekeeping role(s). In addition, overall Sus activity and expression of SUS2 increased significantly in seedlings germinated and grown in hypoxia (submerged conditions), suggesting a role in increasing sucrose metabolism as a response to environmental stress. SUS3 and SUS4 were predominantly expressed in the caryopsis, indicating potential roles in carbon allocation within the filling grain. Transcript levels of SUS5 and SUS6 were low in all tissues examined, and were suppressed in germinating shoots under submergence.
 +
  Sucrose is cleaved ''in vivo'' either by sucrose synthase (Sus) (UDP-glucose: D-fructose 2-glucosyl-transferase, EC 2.4.1.13) or by invertase. Sus catalyzes the
 +
reversible conversion of sucrose and UDP into UDP-glucose and fructose. There is considerable evidence to indicate that Sus plays a major role(s) in metabolism in a number of different growth processes within a variety of sink tissues.
  
 
===Expression===
 
===Expression===

Revision as of 12:28, 17 May 2014

Please input one-sentence summary here.

Annotated Information

Function

  In rice three genes encoding for sucrose synthase (Sus) (EC 2.4.1.13) have previously been characterized, and a further three sequences for putative Sus genes reported. The current work confirms that these six genes comprise the entire rice Sus gene family. An expression analysis was conducted in various rice tissues using real-time quantitative RT-PCR. Sus transcripts were detected in a wide range of tissues and at different developmental stages, indicating that Sus is involved in numerous and diverse growth processes in the rice plant. SUS1 was predominantly expressed in elongating tissues including roots, developing leaves and internodes; a potential role for SUS1 in cellulose synthesis is discussed. SUS2 was shown to be expressed in a wide range of tissues, suggesting that it may perform a number of housekeeping role(s). In addition, overall Sus activity and expression of SUS2 increased significantly in seedlings germinated and grown in hypoxia (submerged conditions), suggesting a role in increasing sucrose metabolism as a response to environmental stress. SUS3 and SUS4 were predominantly expressed in the caryopsis, indicating potential roles in carbon allocation within the filling grain. Transcript levels of SUS5 and SUS6 were low in all tissues examined, and were suppressed in germinating shoots under submergence.
 Sucrose is cleaved in vivo either by sucrose synthase (Sus) (UDP-glucose: D-fructose 2-glucosyl-transferase, EC 2.4.1.13) or by invertase. Sus catalyzes the

reversible conversion of sucrose and UDP into UDP-glucose and fructose. There is considerable evidence to indicate that Sus plays a major role(s) in metabolism in a number of different growth processes within a variety of sink tissues.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os06g0194900

Description

Sucrose synthase 2 (EC 2.4.1.13)

Version

NM_001063582.1 GI:115466895 GeneID:4340386

Length

5882 bp

Definition

Oryza sativa Japonica Group Os06g0194900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:4795629..4801510

Sequence Coding Region

4795896..4795943,4796041..4796179,4796291..4796535,4796666..4796984,4797324..4797548
,4797637..4797803,4797886..4798002,4798087..4798260,4798357..4798452
,4798535..4798751,4798847..4798965,4799115..4799307,4799391..4799542
,4799632..4799752,4800164..4800258

Expression

GEO Profiles:Os06g0194900

Genome Context

<gbrowseImage1> name=NC_008399:4795629..4801510 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:4795629..4801510 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggctgccaagctagctcgcctccacagtctccgcgaacgcctcggtgccaccttctcgtctcatcccaatgagttgattgcactcttctctaggtatgttaaccagggaaagggaatgctccagcgtcaccagctgcttgcggagttcgatgccttgatcgaagctgacaaagagaaatatgctccctttgaagacattctccgggctgctcaggaagccattgtgctgccgccctgggttgcactggccatcaggccaaggcctggtgtctgggactacattcgggtgaatgtaagtgagttggcagtggaagagctgagtgtttctgagtacttggcattcaaggaacagcttgttgatggacacaccaacagcaactttgttcttgagcttgattttgagcccttcaatgcctccttcccgcgcccgtccatgtccaagtccatcggaaatggggtgcagttccttaaccgtcacctgtcgtccaagttgttccaggacaaggagagcctctaccccttgctgaacttcctgaaagcccataaccacaagggcacgacaatgatgctgaatgacagaattcagagccttcgtgggctccaatcatcccttagaaaggcagaagaatatctgatgggcattcctcaagacacgccctactcggagttcaaccacaggttccaagagctcggtttggagaagggttggggtgactgtgcaaagcgtgtgcttgacaccatccacttgcttcttgaccttcttgaggcccctgatccggccaacttggagaagttccttggaactattccaatgatgttcaatgttgttatcctgtctccgcatggatactttgcccaatccaatgtgttgggataccctgatactggtggtcaggttgtgtacattttggaccaagtccgcgctttggagaatgagatgcttttgaggatcaagcagcaaggccttgatatcacacctaagatcctcattgtaaccaggctgttgcctgatgctgttggtactacatgcggccagcgtgtggagaaggttattggaactgagcacactgacattcttcgtgttccattcaggagtgagaatggtatcctccgcaagtggatctcccgttttgatgtctggccattcctggaaacatacactgaggatgttgcaaacgaaattatgagggaaatgcaagccaaacctgatctcatcattggcaattacagtgatggaaaccttgttgccactctgctggctcacaaattaggagttacccagtgtaccattgctcatgccttggagaaaaccaaataccccaactcagacatatacttggacaagtttgacagccagtaccacttctcatgccaattcactgctgatcttatcgccatgaatcacactgatttcatcatcaccagtacattccaagaaattgctggaagcaaggacactgtggggcagtatgaatcacacattgcattcacccttcctgggctttaccgagttgtgcatggcatagatgtttttgatcccaagttcaacattgtctctcctggagctgacatgagtgtctacttcccgtacaccgaggctgacaagaggctcactgctttccaccctgaaattgaggagcttctctacagtgaagtcgagaacgatgaacacaagtttgtattgaaggacaagaacaagccaatcatcttctccatggctcgtcttgaccgagtgaagaacatgacaggtctggttgagatgtatggtaagaatgcacatctcagggatttggcaaaccttgtgattgtttgtggtgaccacggcaatcagtccaaggacagggaggagcaggctgagttcaagaagatgtacggtctcattgaccagtacaagttgaaggggcatatccgctggatctcagctcagatgaaccgtgttcgtaacggggagttgtaccgatacatttgtgacaccaagggagtctttgtccagcctgcattctatgaagcgtttggtctgactgtcatcgaagccatgacatgtggtttgccaacaatcgcaacatgccatggtggccctgctgagattattgttgatggggtgtctggtctgcacattgatccttaccacagtgacaaggctgctgatatcttggtcaacttctttgagaagtgcaagcaggattcaacctactgggacaatatttcacagggaggtctgcagaggatttacgagaagtacacctggaagctgtactctgagaggctgatgaccttgactggtgtatacggattctggaagtacgtaagcaaccttgagaggcgcgagactcgccgttacattgagatgttctatgctctgaaataccgcagcctggccagcgccgtcccattggctgtcgatggagagagcacatccaagtaa</cdnaseq>

Protein Sequence

<aaseq>MAAKLARLHSLRERLGATFSSHPNELIALFSRYVNQGKGMLQRH QLLAEFDALIEADKEKYAPFEDILRAAQEAIVLPPWVALAIRPRPGVWDYIRVNVSEL AVEELSVSEYLAFKEQLVDGHTNSNFVLELDFEPFNASFPRPSMSKSIGNGVQFLNRH LSSKLFQDKESLYPLLNFLKAHNHKGTTMMLNDRIQSLRGLQSSLRKAEEYLMGIPQD TPYSEFNHRFQELGLEKGWGDCAKRVLDTIHLLLDLLEAPDPANLEKFLGTIPMMFNV VILSPHGYFAQSNVLGYPDTGGQVVYILDQVRALENEMLLRIKQQGLDITPKILIVTR LLPDAVGTTCGQRVEKVIGTEHTDILRVPFRSENGILRKWISRFDVWPFLETYTEDVA NEIMREMQAKPDLIIGNYSDGNLVATLLAHKLGVTQCTIAHALEKTKYPNSDIYLDKF DSQYHFSCQFTADLIAMNHTDFIITSTFQEIAGSKDTVGQYESHIAFTLPGLYRVVHG IDVFDPKFNIVSPGADMSVYFPYTEADKRLTAFHPEIEELLYSEVENDEHKFVLKDKN KPIIFSMARLDRVKNMTGLVEMYGKNAHLRDLANLVIVCGDHGNQSKDREEQAEFKKM YGLIDQYKLKGHIRWISAQMNRVRNGELYRYICDTKGVFVQPAFYEAFGLTVIEAMTC GLPTIATCHGGPAEIIVDGVSGLHIDPYHSDKAADILVNFFEKCKQDSTYWDNISQGG LQRIYEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRYIEMFYALKYRSLASAVP LAVDGESTSK</aaseq>

Gene Sequence

<dnaseqindica>5568..5615#5332..5470#4976..5220#4527..4845#3963..4187#3708..3874#3509..3625#3251..3424#3059..3154#2760..2976#2546..2664#2204..2396#1969..2120#1759..1879#1253..1347#aactatttattggtccttctggatctcggagaaaccctccattcgtttgctcgtctctgaccaccattgggtatgttgcttccattgccaaactgttcccttttacccataggctgattgatcttggctgtgtgattttttgcttgggtttttgagctgattcagcggcgcttgcagcctcttgatcgtggtcttggctcgcccatttcttgcgattctttggtgggtcgtcagctgaatcttgcaggagtttttgctgacatgttcttgggtttactgctttcggtaaatctgaaccaagaggggggtttctgctgcagtttagtgggtttactatgagcggattcggggtttcgaggaaaaccggcaaaaaacctcaaatcctcgacctttagttttgctgccacgttgctccgccccattgcagagttctttttgcccccaaatttttttttacttggtgcagtaagaatcgcgcctcagtgattttctcgactcgtagtccgttgatactgtgtcttgcttatcacttgttctgcttaatcttttttgcttcctgaggaatgtcttggtgcctgtcggtggatggcgaaccaaaaatgaagggttttttttttttgaactgagaaaaatctttgggtttttggttggattctttcatggagtcgcgaccttccgtattcttctctttgatctccccgcttgcggattcataatattcggaacttcatgttggctctgcttaatctgtagccaaatcttcatatctccagggatctttcgctctgtcctatcggatttaggaattaggatctaactggtgctaatactaaagggtaatttggaaccatgccattataattttgcaaagtttgagatatgccatcggtatctcaatgatacttactaaaacccaacaaatccatttgataaagctggttcttttatccctttgaaaacattgtcagagtatattggttcaggttgatttattttgaatcagtactcgcactctgcttcgtaaaccatagatgctttcagttgtgtagatgaaacagctgtttttagttatgttttgatcttccaatgcttttgtgtgatgttattagtgttgatttagcatggctttcctgttcagagatagtcttgcaatgcttagtgatggctgttgactaattattcttgtgcaagtgagtggttttggtacgtgttgctaagtgtaacctttctttgcagttcctgaaattgagtcatggctgccaagctagctcgcctccacagtctccgcgaacgcctcggtgccaccttctcgtctcatcccaatgagttgattgcactcttctctaggtgaagatctcaatataatatcttgtgtcttcttggaacctgctactaattgttttgagttttcaatgattttatccatacagttggttagttcttagtcaacccagatgtgaaacgataacatgttagtatgttacaaattcttagctgacaaggttatgcatctctttagttttaatgatggtatctataataatctgtgatgagctctaacatttttgtcttgagtcatgaatcttagatgatgttgaaatattgtttgttcatagctagattaagtacagatcatgtggtcttaaaaataagaagtaaaaatcaggtttatgtggtagtgccattaacatagttcagccgcagaaaggatgtgagatctaagcattggttctatttcttaaatatcactctatgcaggtatgttaaccagggaaagggaatgctccagcgtcaccagctgcttgcggagttcgatgccttgatcgaagctgacaaagagaaatatgctccctttgaagacattctccgggctgctcaggtaaatttggcaatgagccaggatggttatgatagtcaactcaaagtcaaataccagtctttctaacttacttccttgactgtatgtaggaagccattgtgctgccgccctgggttgcactggccatcaggccaaggcctggtgtctgggactacattcgggtgaatgtaagtgagttggcagtggaagagctgagtgtttctgagtacttggcattcaaggaacagcttgttgatggacagtaagtaccagaacgacgatttgcagattataactgaagcaaaataacagtgactgaattttacttctgtttttcttaaacagcaccaacagcaactttgttcttgagcttgattttgagcccttcaatgcctccttcccgcgcccgtccatgtccaagtccatcggaaatggggtgcagttccttaaccgtcacctgtcgtccaagttgttccaggacaaggagagcctctaccccttgctgaacttcctgaaagcccataaccacaagggcacggtaagcttccaatttgtggaacataccaaatgcttttatactagatgttttttcttgtgtgaattgctttaaatgttagtcctttagaaacccacttgacattctctgtaagttccaccaaatgacgggatccgaattttctattacagacaatgatgctgaatgacagaattcagagccttcgtgggctccaatcatcccttagaaaggcagaagaatatctgatgggcattcctcaagacacgccctactcggagttcaaccacaggtgattactttattatttctccttatcatatagcccatgttatactactgcaaatggaataattccttacaatgtgattcatgatttgaatacaggttccaagagctcggtttggagaagggttggggtgactgtgcaaagcgtgtgcttgacaccatccacttgcttcttgaccttcttgaggcccctgatccggccaacttggagaagttccttggaactattccaatgatgttcaatgttgttatcctgtctccgcatggatactttgcccaatccaatgtgttgggataccctgatactggtggtcaggtagagctttttaacaaattttccccttatatacagtacttcaaatatttctagttttgacctgttattctgttgtttgcaggttgtgtacattttggaccaagtccgcgctttggagaatgagatgcttttgaggatcaagcagcaaggccttgatatcacacctaagatcctcattgtatgttcaagatgttggtcttgaatgtttcaagttttaaacacttctcagtgcgaattgtagagtaacgtgcggacatgattttacttgatgcaggtaaccaggctgttgcctgatgctgttggtactacatgcggccagcgtgtggagaaggttattggaactgagcacactgacattcttcgtgttccattcaggagtgagaatggtatcctccgcaagtggatctcccgttttgatgtctggccattcctggaaacatacactgaggtaaatggtttatctgacaacgtccttcagagctgagcacaaaccatgaattctgagagctcatctttttttttttggttgcaggatgttgcaaacgaaattatgagggaaatgcaagccaaacctgatctcatcattggcaattacagtgatggaaaccttgttgccactctgctggctcacaaattaggagttacccaggtatgtttggttgtaaaccactcctttaaatatttctttcattaagtcaattacttatgatttctcttctacatggatacagtgtaccattgctcatgccttggagaaaaccaaataccccaactcagacatatacttggacaagtttgacagccagtaccacttctcatgccaattcactgctgatcttatcgccatgaatcacactgatttcatcatcaccagtacattccaagaaattgctggaaggtaaaattttctaaagagcagtagaatattgctgcgttgtgccaacacctaaacgggtatctgatgtttgtttcctctgtttcttcagcaaggacactgtggggcagtatgaatcacacattgcattcacccttcctgggctttaccgagttgtgcatggcatagatgtttttgatcccaagttcaacattgtctctcctggagctgacatgagtgtctacttcccgtacaccgaggctgacaagaggctcactgctttccaccctgaaattgaggagcttctctacagtgaagtcgagaacgatgaacacaagtgagtactgaactgctggttccgtccctgttattcacctaccatgtaacaaataattaaacactgatttgtgtgtttggtctagctttggctcttcagtctactaagtgccatgcactagaactttgtagatttgaactgcaattcttaattttctcactccttagtagaccacaataataattattgtgtctgacccagctagtttacaatagtgacttcaatgcttgttttttccccttgaacaattgtttactttctagcagtggagtttggcatctaaacttgaatacacgctgttcttttttgtgtataaaatgtttatttaatgttctgcaggtttgtattgaaggacaagaacaagccaatcatcttctccatggctcgtcttgaccgagtgaagaacatgacaggtctggttgagatgtatggtaagaatgcacatctcagggatttggcaaaccttgtgattgtttgtggtgaccacggcaatcagtccaaggacagggaggagcaggctgagttcaagaagatgtacggtctcattgaccagtacaagttgaaggggcatatccgctggatctcagctcagatgaaccgtgttcgtaacggggagttgtaccgatacatttgtgacaccaagggagtctttgtccaggtatatacatacgctgtcatattctactgctatatttctattctgagcttccagtagcaaatgatttctactatttgtaaagaacagccttgtgcttgagactaaaactgcttttaaaattgttttttagcctgcattctatgaagcgtttggtctgactgtcatcgaagccatgacatgtggtttgccaacaatcgcaacatgccatggtggccctgctgagattattgttgatggggtgtctggtctgcacattgatccttaccacagtgacaaggctgctgatatcttggtcaacttctttgagaagtgcaagcaggattcaacctactgggacaatatttcacagggaggtctgcagaggatttacgagaagtatgtatttcatgatctgcaaatatataacattttttttttacgattgacatataactgtagaaatcatgtgtccaatctatattgatcctacaaatttggacttgtcaggtacacctggaagctgtactctgagaggctgatgaccttgactggtgtatacggattctggaagtacgtaagcaaccttgagaggcgcgagactcgccgttacattgagatgttctatgctctgaaataccgcagcctggtaagttactctcgctgttcaacagcttgttaatttcagtattattgcactgagcatatctctgaattctgttgctacatttctttgttgaatccaggccagcgccgtcccattggctgtcgatggagagagcacatccaagtaatggaggggaaaatatgcatcttcagcaggagaagccgtcagctgcattcgaatttgataattttctgtagttgtcatttggcatccatgtttgccatggatgtgtactatgtctaaggtttcagtacttttgcgagattttgggcagtgcttgcctcaaataaacgccggttcctggtgtttatcgttcagaattcaatgcaatgttttattgccgcgcttcctcaatctgtcatgttgaatgaccactccctagtgccctactgtt</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0194900, RefSeq:Os06g0194900