Difference between revisions of "Os06g0194900"

From RiceWiki
Jump to: navigation, search
(Expression)
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
In rice three genes encoding for sucrose synthase (Sus),six genes comprise the entire rice Sus gene family. SUS1 was predominantly expressed in elongating tissues including roots, developing leaves and internodes; a potential role for SUS1 in cellulose synthesis is discussed. SUS2 was shown to be expressed in a wide range of tissues, suggesting that it may perform a number of housekeeping role(s). In addition, overall Sus activity and expression of SUS2 increased significantly in seedlings germinated and grown in hypoxia (submerged conditions), suggesting a role in increasing sucrose metabolism as a response to environmental stress. SUS3 and SUS4 were predominantly expressed in the caryopsis, indicating potential roles in carbon allocation within the filling grain. Transcript levels of SUS5 and SUS6 were low in all tissues examined, and were suppressed in germinating shoots under submergence.
+
In rice three genes encoding for sucrose synthase (Sus),six genes comprise the entire rice Sus gene family.. In addition, overall Sus activity and expression of SUS2 increased significantly in seedlings germinated and grown in hypoxia (submerged conditions), suggesting a role in increasing sucrose metabolism as a response to environmental stress. SUS3 and SUS4 were predominantly expressed in the caryopsis, indicating potential roles in carbon allocation within the filling grain. Transcript levels of SUS5 and SUS6 were low in all tissues examined, and were suppressed in germinating shoots under submergence.
 
Sucrose is cleavedin vivo either by sucrose synthase (Sus) (UDP-glucose: D-fructose 2-glucosyl-transferase, EC 2.4.1.13) or by invertase. Sus catalyzes the reversible conversion of sucrose and UDP into UDP-glucose and fructose. There is considerable evidence to indicate that Sus plays a major role(s) in metabolism in a number of different growth processes within a variety of sink tissues.
 
Sucrose is cleavedin vivo either by sucrose synthase (Sus) (UDP-glucose: D-fructose 2-glucosyl-transferase, EC 2.4.1.13) or by invertase. Sus catalyzes the reversible conversion of sucrose and UDP into UDP-glucose and fructose. There is considerable evidence to indicate that Sus plays a major role(s) in metabolism in a number of different growth processes within a variety of sink tissues.
 
Sus is also proposed to supply UDP-glucose for cellulose synthesis in the cell wall, and in cotton fiber which is supported by experimental evidence from antisense suppression of the enzyme.
 
Sus is also proposed to supply UDP-glucose for cellulose synthesis in the cell wall, and in cotton fiber which is supported by experimental evidence from antisense suppression of the enzyme.

Revision as of 15:01, 17 May 2014

Please input one-sentence summary here.

Annotated Information

Function

In rice three genes encoding for sucrose synthase (Sus),six genes comprise the entire rice Sus gene family.. In addition, overall Sus activity and expression of SUS2 increased significantly in seedlings germinated and grown in hypoxia (submerged conditions), suggesting a role in increasing sucrose metabolism as a response to environmental stress. SUS3 and SUS4 were predominantly expressed in the caryopsis, indicating potential roles in carbon allocation within the filling grain. Transcript levels of SUS5 and SUS6 were low in all tissues examined, and were suppressed in germinating shoots under submergence. Sucrose is cleavedin vivo either by sucrose synthase (Sus) (UDP-glucose: D-fructose 2-glucosyl-transferase, EC 2.4.1.13) or by invertase. Sus catalyzes the reversible conversion of sucrose and UDP into UDP-glucose and fructose. There is considerable evidence to indicate that Sus plays a major role(s) in metabolism in a number of different growth processes within a variety of sink tissues. Sus is also proposed to supply UDP-glucose for cellulose synthesis in the cell wall, and in cotton fiber which is supported by experimental evidence from antisense suppression of the enzyme.

Expression

Sus transcripts were detected in a wide range of tissues and at different developmental stages, indicating that Sus is involved in numerous and diverse growth processes in the rice plant. Sus gene expression has also been reported to be induced in response to environmental stresses such as hypoxia and cold. Sus is reported to be encoded by multiple genes which have distinct and partially overlapping expression patterns. For example, maize has at least three genes encoding Sus, Sh1, Sus1 and Sus3 . Although all three genes are expressed in the developing kernels, Sh1 has the dominant role in cell-wall synthesis whereas Sus1 plays a role in starch synthesis. the entire Sus gene family in rice does in fact comprise the six reported genes. the established sequences have 8950 and 7586 bp for RSus2 and RSus3,respectively

Evolution

the evolution of multiple SS genes is not for the need of diversified catalytic functions but to meet the differential temporal and spatial requirements of the catalytic functiong according to the scheme of plant development and in response to environmental changes.this trend may be especially enhanced in the rice where the plant must adapt to the aerobic( leaf,stem,and grain) and anaerobic (root) conditions simultaneously and accumulate starch in a short period of the life span.[1]

Labs working on this gene

Please input related labs here.

References

<references> [1]

Structured Information

Gene Name

Os06g0194900

Description

Sucrose synthase 2 (EC 2.4.1.13)

Version

NM_001063582.1 GI:115466895 GeneID:4340386

Length

5882 bp

Definition

Oryza sativa Japonica Group Os06g0194900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:4795629..4801510

Sequence Coding Region

4795896..4795943,4796041..4796179,4796291..4796535,4796666..4796984,4797324..4797548
,4797637..4797803,4797886..4798002,4798087..4798260,4798357..4798452
,4798535..4798751,4798847..4798965,4799115..4799307,4799391..4799542
,4799632..4799752,4800164..4800258

Expression

GEO Profiles:Os06g0194900

Genome Context

<gbrowseImage1> name=NC_008399:4795629..4801510 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:4795629..4801510 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggctgccaagctagctcgcctccacagtctccgcgaacgcctcggtgccaccttctcgtctcatcccaatgagttgattgcactcttctctaggtatgttaaccagggaaagggaatgctccagcgtcaccagctgcttgcggagttcgatgccttgatcgaagctgacaaagagaaatatgctccctttgaagacattctccgggctgctcaggaagccattgtgctgccgccctgggttgcactggccatcaggccaaggcctggtgtctgggactacattcgggtgaatgtaagtgagttggcagtggaagagctgagtgtttctgagtacttggcattcaaggaacagcttgttgatggacacaccaacagcaactttgttcttgagcttgattttgagcccttcaatgcctccttcccgcgcccgtccatgtccaagtccatcggaaatggggtgcagttccttaaccgtcacctgtcgtccaagttgttccaggacaaggagagcctctaccccttgctgaacttcctgaaagcccataaccacaagggcacgacaatgatgctgaatgacagaattcagagccttcgtgggctccaatcatcccttagaaaggcagaagaatatctgatgggcattcctcaagacacgccctactcggagttcaaccacaggttccaagagctcggtttggagaagggttggggtgactgtgcaaagcgtgtgcttgacaccatccacttgcttcttgaccttcttgaggcccctgatccggccaacttggagaagttccttggaactattccaatgatgttcaatgttgttatcctgtctccgcatggatactttgcccaatccaatgtgttgggataccctgatactggtggtcaggttgtgtacattttggaccaagtccgcgctttggagaatgagatgcttttgaggatcaagcagcaaggccttgatatcacacctaagatcctcattgtaaccaggctgttgcctgatgctgttggtactacatgcggccagcgtgtggagaaggttattggaactgagcacactgacattcttcgtgttccattcaggagtgagaatggtatcctccgcaagtggatctcccgttttgatgtctggccattcctggaaacatacactgaggatgttgcaaacgaaattatgagggaaatgcaagccaaacctgatctcatcattggcaattacagtgatggaaaccttgttgccactctgctggctcacaaattaggagttacccagtgtaccattgctcatgccttggagaaaaccaaataccccaactcagacatatacttggacaagtttgacagccagtaccacttctcatgccaattcactgctgatcttatcgccatgaatcacactgatttcatcatcaccagtacattccaagaaattgctggaagcaaggacactgtggggcagtatgaatcacacattgcattcacccttcctgggctttaccgagttgtgcatggcatagatgtttttgatcccaagttcaacattgtctctcctggagctgacatgagtgtctacttcccgtacaccgaggctgacaagaggctcactgctttccaccctgaaattgaggagcttctctacagtgaagtcgagaacgatgaacacaagtttgtattgaaggacaagaacaagccaatcatcttctccatggctcgtcttgaccgagtgaagaacatgacaggtctggttgagatgtatggtaagaatgcacatctcagggatttggcaaaccttgtgattgtttgtggtgaccacggcaatcagtccaaggacagggaggagcaggctgagttcaagaagatgtacggtctcattgaccagtacaagttgaaggggcatatccgctggatctcagctcagatgaaccgtgttcgtaacggggagttgtaccgatacatttgtgacaccaagggagtctttgtccagcctgcattctatgaagcgtttggtctgactgtcatcgaagccatgacatgtggtttgccaacaatcgcaacatgccatggtggccctgctgagattattgttgatggggtgtctggtctgcacattgatccttaccacagtgacaaggctgctgatatcttggtcaacttctttgagaagtgcaagcaggattcaacctactgggacaatatttcacagggaggtctgcagaggatttacgagaagtacacctggaagctgtactctgagaggctgatgaccttgactggtgtatacggattctggaagtacgtaagcaaccttgagaggcgcgagactcgccgttacattgagatgttctatgctctgaaataccgcagcctggccagcgccgtcccattggctgtcgatggagagagcacatccaagtaa</cdnaseq>

Protein Sequence

<aaseq>MAAKLARLHSLRERLGATFSSHPNELIALFSRYVNQGKGMLQRH QLLAEFDALIEADKEKYAPFEDILRAAQEAIVLPPWVALAIRPRPGVWDYIRVNVSEL AVEELSVSEYLAFKEQLVDGHTNSNFVLELDFEPFNASFPRPSMSKSIGNGVQFLNRH LSSKLFQDKESLYPLLNFLKAHNHKGTTMMLNDRIQSLRGLQSSLRKAEEYLMGIPQD TPYSEFNHRFQELGLEKGWGDCAKRVLDTIHLLLDLLEAPDPANLEKFLGTIPMMFNV VILSPHGYFAQSNVLGYPDTGGQVVYILDQVRALENEMLLRIKQQGLDITPKILIVTR LLPDAVGTTCGQRVEKVIGTEHTDILRVPFRSENGILRKWISRFDVWPFLETYTEDVA NEIMREMQAKPDLIIGNYSDGNLVATLLAHKLGVTQCTIAHALEKTKYPNSDIYLDKF DSQYHFSCQFTADLIAMNHTDFIITSTFQEIAGSKDTVGQYESHIAFTLPGLYRVVHG IDVFDPKFNIVSPGADMSVYFPYTEADKRLTAFHPEIEELLYSEVENDEHKFVLKDKN KPIIFSMARLDRVKNMTGLVEMYGKNAHLRDLANLVIVCGDHGNQSKDREEQAEFKKM YGLIDQYKLKGHIRWISAQMNRVRNGELYRYICDTKGVFVQPAFYEAFGLTVIEAMTC GLPTIATCHGGPAEIIVDGVSGLHIDPYHSDKAADILVNFFEKCKQDSTYWDNISQGG LQRIYEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRYIEMFYALKYRSLASAVP LAVDGESTSK</aaseq>

Gene Sequence

<dnaseqindica>5568..5615#5332..5470#4976..5220#4527..4845#3963..4187#3708..3874#3509..3625#3251..3424#3059..3154#2760..2976#2546..2664#2204..2396#1969..2120#1759..1879#1253..1347#aactatttattggtccttctggatctcggagaaaccctccattcgtttgctcgtctctgaccaccattgggtatgttgcttccattgccaaactgttcccttttacccataggctgattgatcttggctgtgtgattttttgcttgggtttttgagctgattcagcggcgcttgcagcctcttgatcgtggtcttggctcgcccatttcttgcgattctttggtgggtcgtcagctgaatcttgcaggagtttttgctgacatgttcttgggtttactgctttcggtaaatctgaaccaagaggggggtttctgctgcagtttagtgggtttactatgagcggattcggggtttcgaggaaaaccggcaaaaaacctcaaatcctcgacctttagttttgctgccacgttgctccgccccattgcagagttctttttgcccccaaatttttttttacttggtgcagtaagaatcgcgcctcagtgattttctcgactcgtagtccgttgatactgtgtcttgcttatcacttgttctgcttaatcttttttgcttcctgaggaatgtcttggtgcctgtcggtggatggcgaaccaaaaatgaagggttttttttttttgaactgagaaaaatctttgggtttttggttggattctttcatggagtcgcgaccttccgtattcttctctttgatctccccgcttgcggattcataatattcggaacttcatgttggctctgcttaatctgtagccaaatcttcatatctccagggatctttcgctctgtcctatcggatttaggaattaggatctaactggtgctaatactaaagggtaatttggaaccatgccattataattttgcaaagtttgagatatgccatcggtatctcaatgatacttactaaaacccaacaaatccatttgataaagctggttcttttatccctttgaaaacattgtcagagtatattggttcaggttgatttattttgaatcagtactcgcactctgcttcgtaaaccatagatgctttcagttgtgtagatgaaacagctgtttttagttatgttttgatcttccaatgcttttgtgtgatgttattagtgttgatttagcatggctttcctgttcagagatagtcttgcaatgcttagtgatggctgttgactaattattcttgtgcaagtgagtggttttggtacgtgttgctaagtgtaacctttctttgcagttcctgaaattgagtcatggctgccaagctagctcgcctccacagtctccgcgaacgcctcggtgccaccttctcgtctcatcccaatgagttgattgcactcttctctaggtgaagatctcaatataatatcttgtgtcttcttggaacctgctactaattgttttgagttttcaatgattttatccatacagttggttagttcttagtcaacccagatgtgaaacgataacatgttagtatgttacaaattcttagctgacaaggttatgcatctctttagttttaatgatggtatctataataatctgtgatgagctctaacatttttgtcttgagtcatgaatcttagatgatgttgaaatattgtttgttcatagctagattaagtacagatcatgtggtcttaaaaataagaagtaaaaatcaggtttatgtggtagtgccattaacatagttcagccgcagaaaggatgtgagatctaagcattggttctatttcttaaatatcactctatgcaggtatgttaaccagggaaagggaatgctccagcgtcaccagctgcttgcggagttcgatgccttgatcgaagctgacaaagagaaatatgctccctttgaagacattctccgggctgctcaggtaaatttggcaatgagccaggatggttatgatagtcaactcaaagtcaaataccagtctttctaacttacttccttgactgtatgtaggaagccattgtgctgccgccctgggttgcactggccatcaggccaaggcctggtgtctgggactacattcgggtgaatgtaagtgagttggcagtggaagagctgagtgtttctgagtacttggcattcaaggaacagcttgttgatggacagtaagtaccagaacgacgatttgcagattataactgaagcaaaataacagtgactgaattttacttctgtttttcttaaacagcaccaacagcaactttgttcttgagcttgattttgagcccttcaatgcctccttcccgcgcccgtccatgtccaagtccatcggaaatggggtgcagttccttaaccgtcacctgtcgtccaagttgttccaggacaaggagagcctctaccccttgctgaacttcctgaaagcccataaccacaagggcacggtaagcttccaatttgtggaacataccaaatgcttttatactagatgttttttcttgtgtgaattgctttaaatgttagtcctttagaaacccacttgacattctctgtaagttccaccaaatgacgggatccgaattttctattacagacaatgatgctgaatgacagaattcagagccttcgtgggctccaatcatcccttagaaaggcagaagaatatctgatgggcattcctcaagacacgccctactcggagttcaaccacaggtgattactttattatttctccttatcatatagcccatgttatactactgcaaatggaataattccttacaatgtgattcatgatttgaatacaggttccaagagctcggtttggagaagggttggggtgactgtgcaaagcgtgtgcttgacaccatccacttgcttcttgaccttcttgaggcccctgatccggccaacttggagaagttccttggaactattccaatgatgttcaatgttgttatcctgtctccgcatggatactttgcccaatccaatgtgttgggataccctgatactggtggtcaggtagagctttttaacaaattttccccttatatacagtacttcaaatatttctagttttgacctgttattctgttgtttgcaggttgtgtacattttggaccaagtccgcgctttggagaatgagatgcttttgaggatcaagcagcaaggccttgatatcacacctaagatcctcattgtatgttcaagatgttggtcttgaatgtttcaagttttaaacacttctcagtgcgaattgtagagtaacgtgcggacatgattttacttgatgcaggtaaccaggctgttgcctgatgctgttggtactacatgcggccagcgtgtggagaaggttattggaactgagcacactgacattcttcgtgttccattcaggagtgagaatggtatcctccgcaagtggatctcccgttttgatgtctggccattcctggaaacatacactgaggtaaatggtttatctgacaacgtccttcagagctgagcacaaaccatgaattctgagagctcatctttttttttttggttgcaggatgttgcaaacgaaattatgagggaaatgcaagccaaacctgatctcatcattggcaattacagtgatggaaaccttgttgccactctgctggctcacaaattaggagttacccaggtatgtttggttgtaaaccactcctttaaatatttctttcattaagtcaattacttatgatttctcttctacatggatacagtgtaccattgctcatgccttggagaaaaccaaataccccaactcagacatatacttggacaagtttgacagccagtaccacttctcatgccaattcactgctgatcttatcgccatgaatcacactgatttcatcatcaccagtacattccaagaaattgctggaaggtaaaattttctaaagagcagtagaatattgctgcgttgtgccaacacctaaacgggtatctgatgtttgtttcctctgtttcttcagcaaggacactgtggggcagtatgaatcacacattgcattcacccttcctgggctttaccgagttgtgcatggcatagatgtttttgatcccaagttcaacattgtctctcctggagctgacatgagtgtctacttcccgtacaccgaggctgacaagaggctcactgctttccaccctgaaattgaggagcttctctacagtgaagtcgagaacgatgaacacaagtgagtactgaactgctggttccgtccctgttattcacctaccatgtaacaaataattaaacactgatttgtgtgtttggtctagctttggctcttcagtctactaagtgccatgcactagaactttgtagatttgaactgcaattcttaattttctcactccttagtagaccacaataataattattgtgtctgacccagctagtttacaatagtgacttcaatgcttgttttttccccttgaacaattgtttactttctagcagtggagtttggcatctaaacttgaatacacgctgttcttttttgtgtataaaatgtttatttaatgttctgcaggtttgtattgaaggacaagaacaagccaatcatcttctccatggctcgtcttgaccgagtgaagaacatgacaggtctggttgagatgtatggtaagaatgcacatctcagggatttggcaaaccttgtgattgtttgtggtgaccacggcaatcagtccaaggacagggaggagcaggctgagttcaagaagatgtacggtctcattgaccagtacaagttgaaggggcatatccgctggatctcagctcagatgaaccgtgttcgtaacggggagttgtaccgatacatttgtgacaccaagggagtctttgtccaggtatatacatacgctgtcatattctactgctatatttctattctgagcttccagtagcaaatgatttctactatttgtaaagaacagccttgtgcttgagactaaaactgcttttaaaattgttttttagcctgcattctatgaagcgtttggtctgactgtcatcgaagccatgacatgtggtttgccaacaatcgcaacatgccatggtggccctgctgagattattgttgatggggtgtctggtctgcacattgatccttaccacagtgacaaggctgctgatatcttggtcaacttctttgagaagtgcaagcaggattcaacctactgggacaatatttcacagggaggtctgcagaggatttacgagaagtatgtatttcatgatctgcaaatatataacattttttttttacgattgacatataactgtagaaatcatgtgtccaatctatattgatcctacaaatttggacttgtcaggtacacctggaagctgtactctgagaggctgatgaccttgactggtgtatacggattctggaagtacgtaagcaaccttgagaggcgcgagactcgccgttacattgagatgttctatgctctgaaataccgcagcctggtaagttactctcgctgttcaacagcttgttaatttcagtattattgcactgagcatatctctgaattctgttgctacatttctttgttgaatccaggccagcgccgtcccattggctgtcgatggagagagcacatccaagtaatggaggggaaaatatgcatcttcagcaggagaagccgtcagctgcattcgaatttgataattttctgtagttgtcatttggcatccatgtttgccatggatgtgtactatgtctaaggtttcagtacttttgcgagattttgggcagtgcttgcctcaaataaacgccggttcctggtgtttatcgttcagaattcaatgcaatgttttattgccgcgcttcctcaatctgtcatgttgaatgaccactccctagtgccctactgtt</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0194900, RefSeq:Os06g0194900

  1. 1.0 1.1 Ju-Wei HUANG;Jen-Tao CHEN;Wei-Ping YU;Lie-Fen SHYUR;Ai-Yu WANG;Hsien-Yi SUNG;Ping-Du LEE;Jong-Ching Su Complete Structures of Three Rice Sucrose Synthase Isogenes and Differential Regulation of Their Expressions Bioscience, Biotechnology, and Biochemistry, 1996, 60(2): 233-239