Difference between revisions of "Os03g0110800"

From RiceWiki
Jump to: navigation, search
(Function)
(Expression)
Line 9: Line 9:
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
1. RT-PCR analysis revealed that OsDRM2 is expressed constitutively. OsDRM2 encodes a protein of 584 amino acids, containing two ubiquitin-associated (UBA) domains and conserved catalytic domains(Fig 4)[1].
 +
2. Peng. et al. cloned and expressed one of these homologues,OsDRM2(DMT706), in both E. coli and S.cerevisiae. De novo methylation activity was present in the transformants of both organisms. The recombinant OsDRM protein can methylate any type of cytosine nucleotide, including those in the patterns CG, CHG, and CHH. Evidence of cytosine methylation was observed in the genomic DNA of S. cerevisiae that expressed the OsDRM2 gene based on MSAP assays, bisulfite sequencing and a test of cytosine methylation by endonuclease digestion. This evidence demonstrated that the OsDRM2protein can not only methylate cytosine nucleotidesin vivo in an RdDM pathway-free cellular environment but can also methylate cytosine nucleotides in vitro(Fig 5)[2].
 +
3. Non-coding  RNAs,  especially  small  RNAs,  play  important  roles in  the expression of OsDRM2. For instance, miR820 negatively regulates the expression of OsDRM2[3-5]. And expression levels of various TEs are increased quite sensitively in response to decreased OsDRM2 expression and DNA methylation at TE loci(Fig 6)[3].
  
 
===Evolution===
 
===Evolution===

Revision as of 17:22, 17 May 2014

Please input one-sentence summary here.

Annotated Information

Function

OsDRM2(Os03g0110800) is the majorDRM1/2-type methyltransferase gene in rice. OsDRM2 is responsible for de novo, CG and non-CG methylation in rice genomic sequences, and that DNA methylation regulated by OsDRM2 is essential for proper rice development in both vegetative and reproductive stages[1]. 1. Targeted disruptants of rice OsDRM2 displayed pleiotropic developmental phenotypes in both vegetative and reproductive stages, including growth defects, semi-dwarfed stature, reductions in tiller number, delayed heading or no heading, abnormal panicle and spikelet morphology, and complete sterility(Fig 1)[1]. 2. OsDRM2is required not only for DNA methylation ofRIRE7/CRR1sequences and5S rDNA repeats, but also for transcriptional silencing of RIRE7/CRR1 retrotransposons(Fig 2)[1]. 3. Impaired growth and abnormal DNA methylation of osdrm2 disruptants were restored by the complementation of wild-typeOsDRM2cDNA(Fig 3)[1].

Expression

1. RT-PCR analysis revealed that OsDRM2 is expressed constitutively. OsDRM2 encodes a protein of 584 amino acids, containing two ubiquitin-associated (UBA) domains and conserved catalytic domains(Fig 4)[1]. 2. Peng. et al. cloned and expressed one of these homologues,OsDRM2(DMT706), in both E. coli and S.cerevisiae. De novo methylation activity was present in the transformants of both organisms. The recombinant OsDRM protein can methylate any type of cytosine nucleotide, including those in the patterns CG, CHG, and CHH. Evidence of cytosine methylation was observed in the genomic DNA of S. cerevisiae that expressed the OsDRM2 gene based on MSAP assays, bisulfite sequencing and a test of cytosine methylation by endonuclease digestion. This evidence demonstrated that the OsDRM2protein can not only methylate cytosine nucleotidesin vivo in an RdDM pathway-free cellular environment but can also methylate cytosine nucleotides in vitro(Fig 5)[2]. 3. Non-coding RNAs, especially small RNAs, play important roles in the expression of OsDRM2. For instance, miR820 negatively regulates the expression of OsDRM2[3-5]. And expression levels of various TEs are increased quite sensitively in response to decreased OsDRM2 expression and DNA methylation at TE loci(Fig 6)[3].

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os03g0110800

Description

Similar to DNA methyltransferase

Version

NM_001055253.1 GI:115450234 GeneID:4331357

Length

3670 bp

Definition

Oryza sativa Japonica Group Os03g0110800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:611011..614680

Sequence Coding Region

611181..611186,611747..611869,611985..612084,612169..612215,612294..612452
,613035..613131,613211..613302,613392..614561

Expression

GEO Profiles:Os03g0110800

Genome Context

<gbrowseImage1> name=NC_008396:611011..614680 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:611011..614680 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggtggactgggcttcagatagcgacaatgataagttcgagtgggacacagacggtgaggctgagacctcatctgccccggccctaaggaacatagatgctcctggtccgtccacgaggctgccgcaggatgcaaatgggaaggccaacgggtcaggtgctttggttgctgaatttatgggaatgggattcccaaaagaaatgatcttgaaagcgattaaggagattggggatacagatacagagcaattgcttgagttacttctgacttatcaggcaataggcggtgacgcttcagtgggtaactgctctgcttcggcctgtgccccccagactcttgaagtcgacgaggaggaggatgatactaattgggatgaatatgatactgctggcaattgtgacaggactcctcactctgatggttctggtgacgaggatttctttcaagaaatgtcagagaaggatgaaaaaatgaagtccttagtcaacatgggttttcctgaagatgaagcaaagatggctatcgatagatgtctcgatgcgcctgtagcagtgttggttgattcaatctatgcatcacaggaagcaggaaatggttactctgcaaacttatctgactatgaggatacagagttcagttcctttggaggaagaaagaaaacaagatttgtggatggaagcaagaagagaaagcggtatggaagtgggccatctgggaatcaagtgccgtttgatggcagccacgaagagcccatgcctcttccaaatccaatggtgggattcagcttgcccaatgagaggttaaggtcagtccacagaaatcttcctgaccaagctcttgggccaccattcttttactatgaaaacgtggccctagctccaaaaggtgtatggacaaccatctcaaggtttttatatgacattcagcctgagtttgtggactccaagtacttttgtgctgctgccaggaagaggggttatattcataacctgccgattgagaacaggtcacctgttctcccaatgcctcccaaaacaatatctgaagcctttcctaataccaagaggtggtggccttcctgggatccaaggaggcagttcaactgcttgcaaacttgtatggcaagcgcaaagcttacagagcgaattcgttgtgctttgggtagattcagtgatgtaccaactccacaagttcagaagtatgtcttggacgaatgtaggaaatggaacctagtttgggtcggaaagaataaggtcgctcctctagagcctgatgagatggagttcctgttagggtaccctagaaaccacactaggggagttagcaggacggagaggtacagggctctcgggaattcattccaagttgatacagtagcataccatctctctgtgctgagggacctgtttcccaatggaatgaatgtcttatccctgttttctggtattggaggagcagaggtagctctccacagactggggatacatatgaaaacagtgatctctgttgagaaatcagaagtgaacagaacgattctgaagagctggtgggatcagacacaaactggaacgctgattgaaatcgccgacgtgcggcatcttactactgaaagaattgaaacattcatcagaaggtttggcggttttgacctggtgattggtggcagcccgtgcaacaaccttgctggcagcaaccgccatcaccgagatggtctggagggcgagcactccgcgctcttctacgattacattagaatattagaacatgtaaaggctaccatgtcagcagtctag</cdnaseq>

Protein Sequence

<aaseq>MVDWASDSDNDKFEWDTDGEAETSSAPALRNIDAPGPSTRLPQD ANGKANGSGALVAEFMGMGFPKEMILKAIKEIGDTDTEQLLELLLTYQAIGGDASVGN CSASACAPQTLEVDEEEDDTNWDEYDTAGNCDRTPHSDGSGDEDFFQEMSEKDEKMKS LVNMGFPEDEAKMAIDRCLDAPVAVLVDSIYASQEAGNGYSANLSDYEDTEFSSFGGR KKTRFVDGSKKRKRYGSGPSGNQVPFDGSHEEPMPLPNPMVGFSLPNERLRSVHRNLP DQALGPPFFYYENVALAPKGVWTTISRFLYDIQPEFVDSKYFCAAARKRGYIHNLPIE NRSPVLPMPPKTISEAFPNTKRWWPSWDPRRQFNCLQTCMASAKLTERIRCALGRFSD VPTPQVQKYVLDECRKWNLVWVGKNKVAPLEPDEMEFLLGYPRNHTRGVSRTERYRAL GNSFQVDTVAYHLSVLRDLFPNGMNVLSLFSGIGGAEVALHRLGIHMKTVISVEKSEV NRTILKSWWDQTQTGTLIEIADVRHLTTERIETFIRRFGGFDLVIGGSPCNNLAGSNR HHRDGLEGEHSALFYDYIRILEHVKATMSAV</aaseq>

Gene Sequence

<dnaseqindica>171..176#737..859#975..1074#1159..1205#1284..1442#2025..2121#2201..2292#2382..3551#aacgccgtgtggtcgccatcgccatcgccttcctcctcctcctcctccgccgccgcgcgcttcctcgccaccgcgcgcccagggccatcggcggcggacgccctcgcccacgcgcgcgagagaggggggcgagagattatcggacgagtcgctttgcggagctttctagaatggtggtaagggctcccgctccccccctccgaagcctcctcttcctctctcctccaatctccatcctgctgctgctgcatgatgttagtttggccgtgccgcggcggacgaccctcctcgtcgttgttcgtggattgctccgtgcacgattaggttgtgggtttccgtttgggattgggatggaggggctcctctggtctgtttagtcgcgaaagaatgatactttcttgtatgttttgctgcattttggatcctaaaattatctgatactgtattgatgtcgcgcttgagaattcgattttgcgatgtcgcgtgaacagttcgggcttgcggagcgtggaggagcagaatatttccccccttttgatttggatttagggtttaactgtttggctatccccttgaaatttgatgagggctacgtgatataggggtggcagtatgcctcatacaagatgctacattcaacccgattcagtacttgcgttaatttttctcctctgaatcgccttgttttcactgttagtcgggatatttcagacgtgttgcttaatttatgtcacaggactgggcttcagatagcgacaatgataagttcgagtgggacacagacggtgaggctgagacctcatctgccccggccctaaggaacatagatgctcctggtccgtccacgaggctgccgcaggtaggagatagaggtctatctttgaacacacgtgctagtcatttgttcaaaccatgttgttactttactgtaattataatcaaaatgtggtgtttgtttgtggaactgtctgaaggatgcaaatgggaaggccaacgggtcaggtgctttggttgctgaatttatgggaatgggattcccaaaagaaatgatcttgaaagcgattaaggagattggtaacgataacaataatctagttctcttatttgcttctggttgcattttgaatcttctgtttcaactgctgtcttttctttcaggggatacagatacagagcaattgcttgagttacttctgacttatcaggtatttgcccacatggttgcatcactctgtttattattatctaatgctctactgtacaagtgatgccgtgtaatgcaggcaataggcggtgacgcttcagtgggtaactgctctgcttcggcctgtgccccccagactcttgaagtcgacgaggaggaggatgatactaattgggatgaatatgatactgctggcaattgtgacaggactcctcactctgatggttctggtgacgaggtatttacatgaccccctccttggtcattatatatttatatgcacttgctgtgtctatttcttgaccagtttccctgatcatggctgcaccattttttgcacttgcttcatgctaagaacacattcccttattaatacctatgtaagtgaactactggtcgtataataaattagaaaatttcatacctgtgttctatttcactcttagtaaacaagtatagatatggttagctatactgcagtgctgtagtcttttgtatctataaaaccatacatgtccctgtagggttgttaaaggagctttgttgatccagcccttccttccatcattctatgcatctccagttagcattttctttatggtgcctttgtagtgagagttagcagaactactgtagaaccatcagagagaggatcatatatttggtagcagtaaattgtaggctttgcaaatggtatatgtgtataactgtatatgtgatgcctgcattagttgctttattaataggttattctggactgcaagtcattagagagatgtaacaagtgttttcaatttgcctttaatgtgcttttatgcaggatttctttcaagaaatgtcagagaaggatgaaaaaatgaagtccttagtcaacatgggttttcctgaagatgaagcaaagatggctatcgatagatgtggtatgcctctattgaatttgatgctttgacaggaaggaaccttattctgctgcctttgttggcttaaatttcccaggtctcgatgcgcctgtagcagtgttggttgattcaatctatgcatcacaggaagcaggaaatggttactctgcaaacttatctgactatgaggtaccttgtgattataatgcatctgaatcaataggttgtttcatttcattaaatataacggcattggcatcatctttataattgtgcaggatacagagttcagttcctttggaggaagaaagaaaacaagatttgtggatggaagcaagaagagaaagcggtatggaagtgggccatctgggaatcaagtgccgtttgatggcagccacgaagagcccatgcctcttccaaatccaatggtgggattcagcttgcccaatgagaggttaaggtcagtccacagaaatcttcctgaccaagctcttgggccaccattcttttactatgaaaacgtggccctagctccaaaaggtgtatggacaaccatctcaaggtttttatatgacattcagcctgagtttgtggactccaagtacttttgtgctgctgccaggaagaggggttatattcataacctgccgattgagaacaggtcacctgttctcccaatgcctcccaaaacaatatctgaagcctttcctaataccaagaggtggtggccttcctgggatccaaggaggcagttcaactgcttgcaaacttgtatggcaagcgcaaagcttacagagcgaattcgttgtgctttgggtagattcagtgatgtaccaactccacaagttcagaagtatgtcttggacgaatgtaggaaatggaacctagtttgggtcggaaagaataaggtcgctcctctagagcctgatgagatggagttcctgttagggtaccctagaaaccacactaggggagttagcaggacggagaggtacagggctctcgggaattcattccaagttgatacagtagcataccatctctctgtgctgagggacctgtttcccaatggaatgaatgtcttatccctgttttctggtattggaggagcagaggtagctctccacagactggggatacatatgaaaacagtgatctctgttgagaaatcagaagtgaacagaacgattctgaagagctggtgggatcagacacaaactggaacgctgattgaaatcgccgacgtgcggcatcttactactgaaagaattgaaacattcatcagaaggtttggcggttttgacctggtgattggtggcagcccgtgcaacaaccttgctggcagcaaccgccatcaccgagatggtctggagggcgagcactccgcgctcttctacgattacattagaatattagaacatgtaaaggctaccatgtcagcagtctagtttaagctatcacattaactaactctgtgatttattgttgttaacgaagttagaacctgttgattgatattgctgaacctgatgtgatgttattgcactcaaacaggagtgttttttcc</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0110800, RefSeq:Os03g0110800