Difference between revisions of "Os02g0131800"

From RiceWiki
Jump to: navigation, search
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
This gene is called Nramp(natural resistance-associated macrophage protein) aluminum transporter 1, which is a member of Nramp family and it is a plasma membrane-localized aluminum transporter recently identified in rice. We all known that the Aluminum (Al) is the most abundant metal in the Earth's crust, but its trivalent ionic form is highly toxic to all organisms at low concentrations. While the rice has the most Al-tolerant cereal crop and the researcher has found that the tolerant of aluminum is concerned with this gene. When expressed in yeast, Nrat1 transports trivalent Al ion, but not other divalent ions, such as manganese, iron, and cadmium, or the Al–citrate complex. Nrat1 is localized at the plasma membranes of all cells of root tips except epidermal cells. Knockout of Nrat1 resulted in decreased Al uptake, increased Al binding to cell wall, and enhanced Al sensitivity, but did not affect the tolerance to other metals. Expression of Nrat1 is up-regulated by Al in the roots and regulated by a C2H2 zinc finger transcription factor (ART1). We therefore concluded that Nrat1 is a plasma membrane-localized transporter for trivalent Al, which is required for a prior step of final Al detoxification through sequestration of Al into vacuoles.
  
 
===Expression===
 
===Expression===

Revision as of 08:42, 18 May 2014

Please input one-sentence summary here.

Annotated Information

Function

This gene is called Nramp(natural resistance-associated macrophage protein) aluminum transporter 1, which is a member of Nramp family and it is a plasma membrane-localized aluminum transporter recently identified in rice. We all known that the Aluminum (Al) is the most abundant metal in the Earth's crust, but its trivalent ionic form is highly toxic to all organisms at low concentrations. While the rice has the most Al-tolerant cereal crop and the researcher has found that the tolerant of aluminum is concerned with this gene. When expressed in yeast, Nrat1 transports trivalent Al ion, but not other divalent ions, such as manganese, iron, and cadmium, or the Al–citrate complex. Nrat1 is localized at the plasma membranes of all cells of root tips except epidermal cells. Knockout of Nrat1 resulted in decreased Al uptake, increased Al binding to cell wall, and enhanced Al sensitivity, but did not affect the tolerance to other metals. Expression of Nrat1 is up-regulated by Al in the roots and regulated by a C2H2 zinc finger transcription factor (ART1). We therefore concluded that Nrat1 is a plasma membrane-localized transporter for trivalent Al, which is required for a prior step of final Al detoxification through sequestration of Al into vacuoles.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os02g0131800

Description

Similar to Root-specific metal transporter

Version

NM_001052329.1 GI:115444028 GeneID:4328200

Length

4069 bp

Definition

Oryza sativa Japonica Group Os02g0131800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:1658576..1662644

Sequence Coding Region

1658757..1659089,1659223..1659318,1659430..1659561,1659748..1659852,1660020..1660193
,1660283..1660352,1660458..1660639,1660738..1660847,1660948..1661052
,1661153..1661231,1662128..1662168,1662283..1662358,1662455..1662589

Expression

GEO Profiles:Os02g0131800

Genome Context

<gbrowseImage1> name=NC_008395:1658576..1662644 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:1658576..1662644 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggaagggactggtgagatgagagaggttggacgagaaactctccatggaggtgtggtgcagagtgttagtgagactgatgagtacaaagaaaagactattgacagtgaaaaagatgggcagtttcgggtgcagccaagatggaggaaattcttggctcatgttgggcctggagctctggtggccattggcttcctagatcctagcaacttggaaactgacatgcaagctggagctgacttcaagtatgagcttctgtgggtcatcttagttgggatggtctttgcacttctgatccaaacattagctgccaaccttggagtgaaaacaggaaggcaccttgctgaactgtgcagggaagagtacccgcactatgtcaacattttcttatggatcattgcggagttggcggtgatttctgatgacattcctgaagtgttgggcacagcttttgcgttcaacatattgcttaagattccagtgtgggctggagttattctcacagtgttcagcaccctcttgcttcttggagtacagagatttggggctcggaagctggagttcatcatagcagcattcatgttcactatggcagcttgcttcttcggagagctaagctatttgaggccgtctgcaggagaggtggtcaagggcatgtttgtcccttctctccaagggaaaggcgctgctgccaatgcgatcgcactctttggcgctatcatcacaccatacaacttgttcttgcactctgctctggtcctgtcaaggaagaccccacgatcagacaaaagcatcagagctgcttgcagatacttccttattgagtgtagtcttgcattcatcgtggctttcctcataaatgtttcagtcgttgttgttgctggatccatttgcaatgcgaataatctttctccagctgatgccaacacgtgtggtgacctaactctgcaatccacacctcttttactcaggaatgttttggggagatcaagctcggtggtgtatgctgttgcgctgctagcttctgggcaaagcaccactatcagttgcacgttcgctgggcaggtcatcatgcaggggtttctggacatgaagatgaagaattgggtaaggaacctcatcacccgagtcatcgccatagctcctagcctcatcgtctccattgtcagtggtccctcaggcgccggcaagctaatcatcctgtcatcaatgatcctgtcatttgagctgccgttcgctctcatccctctactcaagttctgcaacagcagcaagaaagttggacccctcaaggaatccatctatacggtggtgatcgcgtggatcctgagcttcgcgctcatcgtcgtcaacacctacttcctagtgtggacatacgtggactggctcgtccacaacaacctccccaagtatgccaatggcctcatctccgtggtggtgttcgcgctcatggccgcctacctggtcgccgtcgtctacctgacgttcaggaaggacacggtggcgacgtacgtgccggtgccggagcgggcgcaggcgcaggtggaggccggcgggacgccggtggtggacgcctccgccgccgacgaggaccagccggctccgtacaggaaggaccttgccgatgcttccatgtag</cdnaseq>

Protein Sequence

<aaseq>MEGTGEMREVGRETLHGGVVQSVSETDEYKEKTIDSEKDGQFRV QPRWRKFLAHVGPGALVAIGFLDPSNLETDMQAGADFKYELLWVILVGMVFALLIQTL AANLGVKTGRHLAELCREEYPHYVNIFLWIIAELAVISDDIPEVLGTAFAFNILLKIP VWAGVILTVFSTLLLLGVQRFGARKLEFIIAAFMFTMAACFFGELSYLRPSAGEVVKG MFVPSLQGKGAAANAIALFGAIITPYNLFLHSALVLSRKTPRSDKSIRAACRYFLIEC SLAFIVAFLINVSVVVVAGSICNANNLSPADANTCGDLTLQSTPLLLRNVLGRSSSVV YAVALLASGQSTTISCTFAGQVIMQGFLDMKMKNWVRNLITRVIAIAPSLIVSIVSGP SGAGKLIILSSMILSFELPFALIPLLKFCNSSKKVGPLKESIYTVVIAWILSFALIVV NTYFLVWTYVDWLVHNNLPKYANGLISVVVFALMAAYLVAVVYLTFRKDTVATYVPVP ERAQAQVEAGGTPVVDASAADEDQPAPYRKDLADASM</aaseq>

Gene Sequence

<dnaseqindica>3556..3888#3327..3422#3084..3215#2793..2897#2452..2625#2293..2362#2006..2187#1798..1907#1593..1697#1414..1492#477..517#287..362#56..190#gagcaagacatactttttcatatcttccagacaaggtgcattagcaacatagaatatggaagggactggtgagatgagagaggttggacgagaaactctccatggaggtgtggtgcagagtgttagtgagactgatgagtacaaagaaaagactattgacagtgaaaaagatgggcagtttcgggtgcaggtaagcgactacattttgcgcattcatggagttctaatgccacaataagctagtgcttgtttcaatcctatgcttactttttgctgggtggaacagccaagatggaggaaattcttggctcatgttgggcctggagctctggtggccattggcttcctagatcctagcaactgtaagctcctatcttttgcctagagcttcatattgttttgatacgctcattaagaaaaaaagaaaaagaagaggttgaggtggtatagcttttttctgaaacatgatttgacagtggaaactgacatgcaagctggagctgacttcaagtatgaggtacactgcatagttcttgcctcttcgtcttggatctgaactacttttacgaactaattaaccatgtgtcatagatttttgcctgcgcatggaaagggtgaatgtaaccaaggttaatcaaataaagacctggtgaaaggctcccaatcttggaataaatgattgaaagactatcttggaaccatttattagttggaaaattgcctggtttggcctttgaaaattgttaactattacaaagaacctacttagtataagcgtcaggaaaacacttatttgggcatcaaatctgaacaaaacagactcttaaacattttagaggtattcctggatgttttgacttgaaatatctttaaaattccaaatataaataatattttgagattttcttgcactgatttcatagctgaacaagaagaattctaaaccttccactgagggtgtggcctttacagaatattgaaatatgtttccttaaaggcctaaataatcaaagtttaaacttaagtctatcctaaggactgtaccaaaaggactccccgttaactagcataagcaacaatgtcttatttgaagaaagaaaattggattattttggggagtacacatataagaacgttggaatatcaatcattgacttgagatgactctatcatgacatgaaccttatatatatgatataatagtagcagtagtacacgaaatcaaacaaagtctcccatgcctagtaaatggtggtcaataatttgtttctttcctaatatttaaagaagacaaattcaatcaagaaacagaaaagtaggagaaaaacaaaattaactatttcgtttttcctgcctcctctttatataaaatgcttcttctggtaacatcaatttacattttacaatgaacagcttctgtgggtcatcttagttgggatggtctttgcacttctgatccaaacattagctgccaaccttggagtgaaaacaggtatatttcacttaaccattaaccttgctctttgcatgctaatcatgcatcatcaccttatcatcttatgttgtccatgcttttgttgagttctgtacaggaaggcaccttgctgaactgtgcagggaagagtacccgcactatgtcaacattttcttatggatcattgcggagttggcggtgatttctgatgacattcctgaaggttgatcgatgttttatttatttatttatttatttatttatttatttatttatttctgtgctagatttagcatgagtaacacgttcttttgttagtgcagtgttgggcacagcttttgcgttcaacatattgcttaagattccagtgtgggctggagttattctcacagtgttcagcaccctcttgcttcttggagtacagagatttggggtgcgcaaagaatttctcagacttatatgattgtcagatgaattacactgagaatgggctactgacgaattgaccttaccatatgacatgtccaccaggctcggaagctggagttcatcatagcagcattcatgttcactatggcagcttgcttcttcggagagctaagctatttgaggccgtctgcaggagaggtggtcaagggcatgtttgtcccttctctccaagggaaaggcgctgctgccaatgcgatcgcactctttggcgctatcatcacaccgtaagaaacccaatcagttatcagggctttggtgatcgtagctactttttacttgatccatggtacaagttcatgagatgaggagttttcataacatgcatgcagatacaacttgttcttgcactctgctctggtcctgtcaaggaagaccccacgatcagacaaaagcatcagagtaggttgcattgataatagatgatgtaatgatcagctatggtttgttgttgagtggctaatggtttgaccctatcttgtttccgataggctgcttgcagatacttccttattgagtgtagtcttgcattcatcgtggctttcctcataaatgtttcagtcgttgttgttgctggatccatttgcaatgcgaataatctttctccagctgatgccaacacgtgtggtgacctaactctgcaatccacacctcttttactcagggtaagaactgttcgaatgttcatttcctggataaaagatagtactttcagaagcatcttatagacatcttgttctgtaatatggaagaaattacagaccagagctcactgaggatcatgtcagacattctgaattcaagccttattttgattatctcttactttcagaatgttttggggagatcaagctcggtggtgtatgctgttgcgctgctagcttctgggcaaagcaccactatcagttgcacgttcgctgggcaggtcatcatgcaggtaattcagttccgtagtgctcacccttgatagtaaacctggagcagggtttgtcaagtttacactattgatcgaggtgttatcaagtttgtacaaactatttgataccttgcatatcatttgtccactcttgagtattatctatttcagtaaatatagccaacttttgttatgataattatccaggggtttctggacatgaagatgaagaattgggtaaggaacctcatcacccgagtcatcgccatagctcctagcctcatcgtctccattgtcagtggtccctcaggcgccggcaagctaatcatcctgtcatcagtaagactcatcaacctgttttcagctttatttttccaattgaacattctgtaggaattcgctttgctcctccaaaagcaacaatatcctgaattcttgatttggatacagatgatcctgtcatttgagctgccgttcgctctcatccctctactcaagttctgcaacagcagcaagaaagttggacccctcaaggaatccatctatgtaagcttccttaaaccatttctccaaccaaaaaacattcacattcacccacccacacaaacacaaacacgaaaaccgattaattcgccatgctagatacataaattggcaaatgatccaataatttttgcagacggtggtgatcgcgtggatcctgagcttcgcgctcatcgtcgtcaacacctacttcctagtgtggacatacgtggactggctcgtccacaacaacctccccaagtatgccaatggcctcatctccgtggtggtgttcgcgctcatggccgcctacctggtcgccgtcgtctacctgacgttcaggaaggacacggtggcgacgtacgtgccggtgccggagcgggcgcaggcgcaggtggaggccggcgggacgccggtggtggacgcctccgccgccgacgaggaccagccggctccgtacaggaaggaccttgccgatgcttccatgtagccttgataaattattgcttgctgagtagtgcattagttattcctcgtcgtcagtgtataactagatgtgttctctggatgatataatgtgattcgtcattgattttttgttcttcttcttgttgttgtttctaagcagcttagctgtaaattaagtttgagaaaaaaaagtgtgcactact</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0131800, RefSeq:Os02g0131800