Difference between revisions of "Os09g0244900"

From RiceWiki
Jump to: navigation, search
(Expression)
(Expression)
Line 6: Line 6:
  
 
===Expression===
 
===Expression===
Ypt/Rabs are activated by guanine-nucleotide exchange factors (GEFs) and the GEF for Ypt1 and Ypt31/32 is the TRAPP complex. TRAPP is a multisubunit modular complex (Sacher et al. 2008), which exists in at least three forms. TRAPP I, which contains five essential subunits, acts as a GEF for Ypt1 (Jones et al. 2000; Wang et al. 2000), and is required for ER-to-Golgi transport (Sacher et al. 1998). Trs85, a TRAPP subunit, nonessential for cell viability, plays a role in autophagy (Meiling-Wesse et al. 2005; Nazarko et al. 2005). A Trs85-containing TRAPP complex, termed TRAPP III, also acts as a Ypt1 GEF (Lynch-Day et al. 2010). TRAPP II, which contains Trs120 and Trs130 in addition to TRAPP I subunits, functions at the trans-Golgi (Sacher et al. 2001). However, currently the Ypt GEF specificity of the TRAPP II complex is under dispute.
+
Ypt/Rabs are activated by guanine-nucleotide exchange factors (GEFs) and the GEF for Ypt1 and Ypt31/32 is the TRAPP complex. TRAPP is a multisubunit modular complex (Sacher et al. 2008), which exists in at least three forms. TRAPP I, which contains five essential subunits, acts as a GEF for Ypt1 (Jones et al. 2000; Wang et al. 2000), and is required for ER-to-Golgi transport (Sacher et al. 1998). Trs85, a TRAPP subunit, nonessential for cell viability, plays a role in autophagy (Meiling-Wesse et al. 2005; Nazarko et al. 2005). A Trs85-containing TRAPP complex, termed TRAPP III, also acts as a Ypt1 GEF (Lynch-Day et al. 2010). TRAPP II, which contains Trs120 and Trs130 in addition to TRAPP I subunits, functions at the trans-Golgi (Sacher et al. 2001). However, currently the Ypt GEF specificity of the TRAPP II complex is under dispute.<ref name="ref2" />.
  
 
On the basis of biochemical and genetic evidence, we have proposed that TRAPP I activates Ypt1 in ER-to-Golgi transport, whereas Ypt31/32 act at the trans-Golgi in both Gogli-to-PM and endosome-to-Golgi transport, and TRAPP II acts as their GEF at least in the former step (Jones et al. 2000; Chen et al. 2005; Morozova et al. 2006). This model is currently being challenged claiming that Ypt1 functions in endosome-to-Golgi transport in addition to its role in ER-to-Golgi transport (Sclafani et al. 2010), and that TRAPP II acts as a GEF for Ypt1 in both steps (Cai et al. 2008; Barrowman et al. 2010; Yip et al. 2010). Here we study the physiological relationship between Ypt1 and Ypt31/32 and two TRAPP complexes, TRAPP III and TRAPP II. Data presented in this article provide support to the idea that TRAPP II acts with Ypt31/32, and not with Ypt1, in endosome-to-Golgi transport.<ref name="ref2" />.
 
On the basis of biochemical and genetic evidence, we have proposed that TRAPP I activates Ypt1 in ER-to-Golgi transport, whereas Ypt31/32 act at the trans-Golgi in both Gogli-to-PM and endosome-to-Golgi transport, and TRAPP II acts as their GEF at least in the former step (Jones et al. 2000; Chen et al. 2005; Morozova et al. 2006). This model is currently being challenged claiming that Ypt1 functions in endosome-to-Golgi transport in addition to its role in ER-to-Golgi transport (Sclafani et al. 2010), and that TRAPP II acts as a GEF for Ypt1 in both steps (Cai et al. 2008; Barrowman et al. 2010; Yip et al. 2010). Here we study the physiological relationship between Ypt1 and Ypt31/32 and two TRAPP complexes, TRAPP III and TRAPP II. Data presented in this article provide support to the idea that TRAPP II acts with Ypt31/32, and not with Ypt1, in endosome-to-Golgi transport.<ref name="ref2" />.

Revision as of 13:42, 19 May 2014

Please input one-sentence summary here.

Annotated Information

Function

The TRAPP complexes, large multimeric assemblies that function in membrane traffic, are guanine nucleotide exchange factors (GEF) that activate the Rab GTPase Ypt1p.Ypt1p is activated by a large multisubunit complex called TRAPP that also functions in tethering. TRAPP is found in two forms: TRAPPI mediates traffic from the ER to the early Golgi, while TRAPPII plays a role in transport to the late Golgi. The two TRAPP complexes share seven subunits (Bet3p, Bet5p, Trs31p, Trs33p, Trs23p, Trs20p, and Trs85p), of which four (Bet3p, Bet5p, Trs23p, Trs31p) are required for the activation of Ypt1p.TRAPP is thus an unusual GEF in that its activity does not reside in a single subunit but instead requires a minimal five-subunit subcomplex comprising four different proteins[1].

Expression

Ypt/Rabs are activated by guanine-nucleotide exchange factors (GEFs) and the GEF for Ypt1 and Ypt31/32 is the TRAPP complex. TRAPP is a multisubunit modular complex (Sacher et al. 2008), which exists in at least three forms. TRAPP I, which contains five essential subunits, acts as a GEF for Ypt1 (Jones et al. 2000; Wang et al. 2000), and is required for ER-to-Golgi transport (Sacher et al. 1998). Trs85, a TRAPP subunit, nonessential for cell viability, plays a role in autophagy (Meiling-Wesse et al. 2005; Nazarko et al. 2005). A Trs85-containing TRAPP complex, termed TRAPP III, also acts as a Ypt1 GEF (Lynch-Day et al. 2010). TRAPP II, which contains Trs120 and Trs130 in addition to TRAPP I subunits, functions at the trans-Golgi (Sacher et al. 2001). However, currently the Ypt GEF specificity of the TRAPP II complex is under dispute.[2].

On the basis of biochemical and genetic evidence, we have proposed that TRAPP I activates Ypt1 in ER-to-Golgi transport, whereas Ypt31/32 act at the trans-Golgi in both Gogli-to-PM and endosome-to-Golgi transport, and TRAPP II acts as their GEF at least in the former step (Jones et al. 2000; Chen et al. 2005; Morozova et al. 2006). This model is currently being challenged claiming that Ypt1 functions in endosome-to-Golgi transport in addition to its role in ER-to-Golgi transport (Sclafani et al. 2010), and that TRAPP II acts as a GEF for Ypt1 in both steps (Cai et al. 2008; Barrowman et al. 2010; Yip et al. 2010). Here we study the physiological relationship between Ypt1 and Ypt31/32 and two TRAPP complexes, TRAPP III and TRAPP II. Data presented in this article provide support to the idea that TRAPP II acts with Ypt31/32, and not with Ypt1, in endosome-to-Golgi transport.[2].

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References=

  1. Harvey F. Chin, Yiying Cai, [...], and Enrique M. De La Cruz.Kinetic Analysis of the Guanine Nucleotide Exchange Activity of TRAPP, a Multimeric Ypt1p Exchange Factor.J Mol Biol. Jun 5, 2009; 389(2): 275–288.
  2. 2.0 2.1 Shenshen Zou, Yutao Liu, [...], and Nava Segev.Modular TRAPP Complexes Regulate Intracellular Protein Trafficking Through Multiple Ypt/Rab GTPases in Saccharomyces cerevisiae.Genetics. Jun 2012; 191(2): 451–460.

Cite error: <ref> tag with name "ref3" defined in <references> is not used in prior text.
Cite error: <ref> tag with name "ref4" defined in <references> is not used in prior text.

Structured Information

Gene Name

Os09g0244900

Description

Transport protein particle (TRAPP) component, Bet3 family protein

Version

NM_001069192.2 GI:297609099 GeneID:4346489

Length

6323 bp

Definition

Oryza sativa Japonica Group Os09g0244900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 9

Location

Chromosome 9:3935276..3941598

Sequence Coding Region

3935389..3935540,3938899..3939016,3939091..3939345

Expression

GEO Profiles:Os09g0244900

Genome Context

<gbrowseImage1> name=NC_008402:3935276..3941598 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008402:3935276..3941598 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggtgcgggaggttgcggagagctgtgtcgacggggtggtgatggagatggtggcggcctactgcggccgcttctacgccgccaagccggagctcgccgcccgccgcatcgaggccatcggcttccaggtcggccaccagctcacggagagatataccatggagcgccctcgatttagtgatcatcttgaagcaatcaaatttatctgcaaagacttttggtcagagctattcaagaagcagattgacaatcttaaaactaatcataggggaacatttgttcttcaagataaccgtttccggtggcttactcgtgtttctatagatccatctgtagagagcatggatgcaactgacaatgactctgcaacactaggggatagcgcagcccaaacaacaagcatgcttctgtactttccatgcgggataataagaggtgccttgaccaatttgggtatttcgtgttctgtcactgcagacatgtccaaccttccagcatgtgagttgcactactccttttcatga</cdnaseq>

Protein Sequence

<aaseq>MVREVAESCVDGVVMEMVAAYCGRFYAAKPELAARRIEAIGFQV GHQLTERYTMERPRFSDHLEAIKFICKDFWSELFKKQIDNLKTNHRGTFVLQDNRFRW LTRVSIDPSVESMDATDNDSATLGDSAAQTTSMLLYFPCGIIRGALTNLGISCSVTAD MSNLPACELHYSFS</aaseq>

Gene Sequence

<dnaseqindica>114..265#3624..3741#3816..4070#tgggttcgtgcgacgggacctcgattcgtccatccagcttccactacccctccgcgcgctgcctagatctttcctctctctcgcaccctcttattggcggaggaggaggagggatggtgcgggaggttgcggagagctgtgtcgacggggtggtgatggagatggtggcggcctactgcggccgcttctacgccgccaagccggagctcgccgcccgccgcatcgaggccatcggcttccaggtcggccaccagctcacggagaggtaaacgaatctctctctctctcttgctggatggatctgctgctgcgcccctcccccgatctttccggcgagtccgccgacgagggcctcagatcttctcagtcggcagtcgctatcggttcttgctgactccgataaattttgaaatgttgcttttagtcgccctaaataagggcttattaatcagatttcgcaacaatatcgagccttagacttgatcgcgaagcacttcttgtctttgggagcaggagtgcagggccttgcctacaatcaaaatttgggttaattggatccgctattataaatttcacggtttagaaaaataccattactatttggtaccattgccattgcaatttcataagtattatcactacagaccttttcataacattttttgttttttaagaccaaattaccccctcttcttccttcttccttcccctctctcctctcttccagccgacgaactcgtatgagttcagcagctcatgccgcaggctgcagcgctggaagagccgccgcgcaggacactgctgccgatggagctgaaggagagtggcatagagttgtgagagcttgcttgcactcatttaagctaggattcagtaatgtcgtgcggaaacgtacaacatccgttggcctatgtagtgtgtcattgtgtatatgcagagacgtacgggacatgcatttgctgcaagtattcagtgactgaaccatgccaggtaggagtgtatgtgtatacaggcttgttcctatatgctgtgtcgtatggtagggcacagcacctcaactggatcacgcctccaacaatgtggcaaacgctcttgccgtctacaacagcctttctagcacaccgtcgtcgacgtgaacggaccaactgctgccggcagcctctctgaactctgccgagactgcagtcctcgccgtgcagtccagcgccgtggccggctacacaatttcgtcggagtttgttaagctggaggacaggagattgggggaaaataagtagatgagggtagaagaaagggacaattttgtcctaaaaactcagggttaattggatccatgccattataaattttttagttttgacgtatgcaattactattcaactattcagagtcataccaatacaatttttcaggtgtggaaatatatcactacatacccctttgatgtgtttcacaaaatttttagaccaaaatgccctcatcttcttcctttgtctcatcccatctcctgtagtcctgttaatcttcttcctcctatttttccccttccggatctgaatctggcaacttgtcttcttccttctcatttcctctgtcggccatgatgccagtgttgtgctgcgccatctagttcctcttattcccttcgccggccaaccaaggagcggagctcgtcgtcggcgcatcgttgtggaaggtgctgctggtgttgttcgcctgcggcgacttcaccatggcacgtggtcgtcgatgggcacatgctgtccatgatctgacagagtggcctttttcatgtgtaatctcaaactgaacatccttttttatgtgcctaattgagttggtcaaacatcccaaaatccattccactagcttctgctgagcagcaagcaaccaactaccagactaccagtacgtccttcaacagcaggaaaccaaccatgtgcaagaaatgggaagaagaagaagatgaacagcagacaggtcgggtagctctgaccagctgctgcagtttcgtgtatatggggctggtggccggcgccaccgggaccaacaccatcgagcaatggcggttggctcggactaggtgctgcggcatccagatccgatgagcctgaacccaacgccatctttggcacagccgactcgagccagcctgtcccaatcggcaaccccttgcactgaacttgcagcaagaattgagagaaagaagatgtacaggagagatggaaggacaccaaggaagaagaagagggcattttggtctaagaattttgttaaacacattgaaggggtatgtagtggtatattttcaatacctggaaaattgtaatggcatagctcttaatagttgaatggtaatggcatatgtcagaactgaaaaaatgctgtgaaagggtatatagcggcatatctctaacacttgtaaaattgtaatggcatgatttcaaatagatgaataataatggtatatttccaaactgcgaaatttacagtggcatagatccaattaacccaccatatatattccacaattccaaatgttcattccataagttttaacttcagtacatgtctagtatttcgaacaggtcacttgtttaaccgtttactgatgtgtatacaaatttgtaattctagacagtttatctattctcttgactggtactgttgtatcagcctttattaatagatcgcataactggatgccgccagcaccaatgttctgtcagacagggtaaaaaatatatcacatgattacagccatacggagtatatatttttatttaaacaagtacaactcttttttactgcatacctggctttcagtgtagggatccgaaaatgttatcactttgaactgcagtatatcctcaaatatggtgggtactggataggttcatctcatatagccttggagatctagataacatagatcattctggagttaattactccccggcattcttcttgaaattgatgatatatttcctaaacttttgtgtgtgtgtgtgcgggaacttcaaaggactcaacgagctgaaacagttgattgaagaacctttgtaccgatactttgattcatatgcgacagagtttaataatgcttacattttatcgtatggacattttctcgtgcaatatgtatgctcattattacgaaaatcctatattccttcagtaaccattgacatccttagttaaaaggatagggtatgtttgatcgatgattgggtgcttgtttatgactattttcttgagcaaagaattttgaagctaactataaaaaaggttcaacccgtattaatcatttacaaatgtttatgatgtttgtaattatttacaaaacaaaaatgctacttagcaattttagttatagtttattctctttttattttacttttttcagaaatgtgtttgcaattgtttatataatggaagtttcattttaattgctaattaaattttgtatgtttttattgcccttggtcatttattgattgtttcctgaagtatcatattcttgagcacaaatgtaactgctgtctgaattgcatatgtgtattgggttcttacctccactccttgtagtgctgcgattaaccataatttctgttcaaaatcagatataccatggagcgccctcgatttagtgatcatcttgaagcaatcaaatttatctgcaaagacttttggtcagagctattcaagaagcagattgacaatcttaaaactaatcatagggtaatgaatttaaaattcgtaccttattttgcgcttgtgacagaactgatgttacttgacttccctatatgcagggaacatttgttcttcaagataaccgtttccggtggcttactcgtgtttctatagatccatctgtagagagcatggatgcaactgacaatgactctgcaacactaggggatagcgcagcccaaacaacaagcatgcttctgtactttccatgcgggataataagaggtgccttgaccaatttgggtatttcgtgttctgtcactgcagacatgtccaaccttccagcatgtgagttgcactactccttttcatgacctttactttgcatgcaactccatgaggttgcaaaatgcactggatggtactccttctgttttcatataattattgccattagctttatttttcaaactcattaaacatggaatacctcaagggaaaaatattaaagtattttgaatgataaatgttatagtattattctttcctactaactaaaaaaattaaaatactacttgtcaaatgttgaatagtatagtcatgctcattgctgttaaaaaaggctgggccagtacttgaattaagaaaatcagatcagataatgctcaacatgagtgtctccatatgagaaattatttggtgaaaaatcttttggtgaatatgatggataagattttcattgtggatatttagtatctcagattgaataaccttatcacttgatcacacaagcatattcaaaagcactctcatgtggccatcattgatgccccaatcatcaaaaccaagcagagaattttgagaccacctgatcaggtagcaagttccagcttagctgcttaggatagatatgtcaggaagaagcagccagtatctttctagatgattttgatttcatccagatccagttcacgcagcaaacaaagtcttccatatgcaccgtatgtggcatcgacaaaaaataagtatcccacctgccattcttatggaccactggacatgcctcccttctttagcgttatttggctgcttggagcctgcttacttagtgaactgtttggggagctccttgctaagggtgcaaggggattctcttcctattcctcgactaaatcctttctgctgatctgttaaaaaaaaatagtatctatttccgtttgcctttcctagaaggttgttcaaatgtttgtagagatattcttcttgtcatggtctttttgtttctgtactctttttaatgggattttttttttcagtccacagcttatatgtattgagctgaaagagaaattcattttgttcattgaaatgtggaagtaatattcgtacaatgaatatttgaaatcccctagggggaaagggccgtaataaatataactcctccattccaaatttaaggcattttagttttgtcctaggtgaacatctctaactctgaccaagttatagaaaaatgcactaacatctaaaacatcaatttaatttcattgaaatccaccatgaaatatgtattgatagtgcattaattgggtactccatcccattaaacaaggcgcaactgctttgtacgcaaagaccaaggaagctcatgtaacttgtgagatggatgctgcagaactagaggctttaaacaaccaaaggaaaccaaagaatagctagtgcatgcatgcgcatgaacagaaattacaggagtcaagaaggtgcagctgccgttgctgccctatattctgggacttttgaaaaaagcagttgcgtctggtataatgggatggagagagtagtgtagatgttaatatagggccaatttggattgctacctaccaaaattttggtagggtagcaaaccaaacacctctattaaaacactacctttgtcataaatttggctttgcccatgaacttgtgtcttatgggtatattttagcttcaatcctaatcaacattttcaactctttaccctacaacattttggtagggtattaatacaaacacaggcccatatttttctataaacttggtcaaggtttgagaagtttgacttataacaaaactaaaatgtcttatagtagtatggaatggagggagtacatgactctaggttaaactattcgttgatgattgcagttttgagaattataacacatttctccatttgtagttttgtaccataaattccctctgccttttgcagctatgactattatgtgaaatattgcaggttcttttgttgtgcgcataaaaacatgagctgcagattttatgcctgcttgttcgatcaagcggtttgaacattaaagagtgcaagcacgcaatagcctgggaaatacgccttgtagctgctcctttttctttctctttgttcttagaggcacctctttacttactgacttcatcataccttcctttgtgcacatcttaagattgggtgtaattttgtgattcgtgtgaacaagagaagacaaaatgtaatatttctcctgagatactggctagagccatgtaattttgttgtctagcagtggagaatgttttatcttgtatgtgatgcccgcgcacagtcacgattt</dnaseqindica>

External Link(s)

NCBI Gene:Os09g0244900, RefSeq:Os09g0244900