Difference between revisions of "Os05g0553400"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
OsMYB55 is a transcription factor of R2R3-MYBs family members.The MYB plant transcription factor family members regulate numerous processes during the plant life cycle and are also involved in response to various environmental stresses.The MYB proteins are classified into three major groups based on the number of adjacent repeats in the binding domain; R1R2R3-MYB, R2R3-MYB, and R1-MYB. Most plant MYB proteins are of the R2R3 type.The R2R3-MYBs are involved in a wide range of physiological responses such as regulation of the isopropanoid and flavonoid pathways,control of the cell cycle, root growth,and various defense and stress responses.Molecular and biochemical analysis revealed that OsMYB55 enhances amino acid metabolic pathways crucial for normal plant growth and development under high temperature.
+
OsMYB55 is a transcription factor of R2R3-MYBs family members.The MYB plant transcription factor family members regulate numerous processes during the plant life cycle and are also involved in response to various environmental stresses[[File:[1]]].The MYB proteins are classified into three major groups based on the number of adjacent repeats in the binding domain; R1R2R3-MYB, R2R3-MYB, and R1-MYB. Most plant MYB proteins are of the R2R3 type.The R2R3-MYBs are involved in a wide range of physiological responses such as regulation of the isopropanoid and flavonoid pathways,control of the cell cycle, root growth,and various defense and stress responses.Molecular and biochemical analysis revealed that OsMYB55 enhances amino acid metabolic pathways crucial for normal plant growth and development under high temperature.
  
 
===Expression===
 
===Expression===

Revision as of 12:36, 20 May 2014

The rice gene OsMYB55 can enhance the vegetative growth and improve grain yield of rice growth under high temperature conditions.

Annotated Information

Function

OsMYB55 is a transcription factor of R2R3-MYBs family members.The MYB plant transcription factor family members regulate numerous processes during the plant life cycle and are also involved in response to various environmental stresses[[File:[1]]].The MYB proteins are classified into three major groups based on the number of adjacent repeats in the binding domain; R1R2R3-MYB, R2R3-MYB, and R1-MYB. Most plant MYB proteins are of the R2R3 type.The R2R3-MYBs are involved in a wide range of physiological responses such as regulation of the isopropanoid and flavonoid pathways,control of the cell cycle, root growth,and various defense and stress responses.Molecular and biochemical analysis revealed that OsMYB55 enhances amino acid metabolic pathways crucial for normal plant growth and development under high temperature.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os05g0553400

Description

Similar to Myb-related transcription factor-like protein (MYB transcription factor)

Version

NM_001062798.1 GI:115465326 GeneID:4339548

Length

1457 bp

Definition

Oryza sativa Japonica Group Os05g0553400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:27606367..27607823

Sequence Coding Region

27606601..27607204,27607297..27607426,27607530..27607665

Expression

GEO Profiles:Os05g0553400

Genome Context

<gbrowseImage1> name=NC_008398:27606367..27607823 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:27606367..27607823 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggggcgcgcgccgtgctgcgacaaggcgagcgtgaagcgggggccgtggtcgccggaggaggacgagcagctgcggagctacgtccagagccacggcatcggcggcaactggatcgcgctcccgcagaaagcagggctcaaccgctgcggcaagagctgcaggctccggtggctcaactacctgaggccggacatcaagcacggcggctacaccgagcaggaggaccacatcatctgctcgctctacaactcgattggaagcaggtggtccatcatcgcgtcgaagctccccggccggactgacaacgacgtcaagaactactggaacaccaagctcaagaagaaagccatgggcgccgtgcagccgcgcgccgccgcctcggcgccgagccaatgcacgtcgtcagcgatggcgccggcgctctcgccggcctcctcgtccgtcaccagctcgagcggcgacgcctgcttcgccgccgccgccaccaccaccaccaccatgtacccgccaccgacgacgccgccgcagcagcagttcatccgcttcgacgcaccacccgcggcggcggcggcggcatccccgaccgacctcgcgcccgtgccaccaccggccaccgtcacggcggacggcgacggcggctgggcgtccgacgccttgtccctcgacgacgtgttcctcggcgagctcacggccggcgagccgctgttcccttacgccgagctgttcagcggcttcgccggcgcggcgccggacagcaaggccaccttggagctctcggcgtgctacttcccgaacatggcggagatgtgggcggcctccgaccacgcctacgccaagccacagggtctctgcaacaccctgacatag</cdnaseq>

Protein Sequence

<aaseq>MGRAPCCDKASVKRGPWSPEEDEQLRSYVQSHGIGGNWIALPQK AGLNRCGKSCRLRWLNYLRPDIKHGGYTEQEDHIICSLYNSIGSRWSIIASKLPGRTD NDVKNYWNTKLKKKAMGAVQPRAAASAPSQCTSSAMAPALSPASSSVTSSSGDACFAA AATTTTTMYPPPTTPPQQQFIRFDAPPAAAAAASPTDLAPVPPPATVTADGDGGWASD ALSLDDVFLGELTAGEPLFPYAELFSGFAGAAPDSKATLELSACYFPNMAEMWAASDH AYAKPQGLCNTLT</aaseq>

Gene Sequence

<dnaseqindica>620..1223#398..527#159..294#atcggtcggtctcggtcgctgccgtccctgtgcttggagtagacacgagccggtgacgcgcatatcgtcttctgctcgagatcgatcgatcgatcgcttggttggttgctgcgactgcgagggaggccgcgggtggtgaggaggattgtgcaaaaaaaatggggcgcgcgccgtgctgcgacaaggcgagcgtgaagcgggggccgtggtcgccggaggaggacgagcagctgcggagctacgtccagagccacggcatcggcggcaactggatcgcgctcccgcagaaagcaggtcggtattagtgcactgctcgtcgtcgtcgatgctagccggtgatgaaacgccatgtttgtatgtgaattctgatgtctgcgtgttctcttgtgtgattcagggctcaaccgctgcggcaagagctgcaggctccggtggctcaactacctgaggccggacatcaagcacggcggctacaccgagcaggaggaccacatcatctgctcgctctacaactcgattggaagcaggtgatgatttaagccggagatgaatatttcttttttctttcactgatcctgttctgagttcttgaactgactctgtttgcgtgcgttgccaggtggtccatcatcgcgtcgaagctccccggccggactgacaacgacgtcaagaactactggaacaccaagctcaagaagaaagccatgggcgccgtgcagccgcgcgccgccgcctcggcgccgagccaatgcacgtcgtcagcgatggcgccggcgctctcgccggcctcctcgtccgtcaccagctcgagcggcgacgcctgcttcgccgccgccgccaccaccaccaccaccatgtacccgccaccgacgacgccgccgcagcagcagttcatccgcttcgacgcaccacccgcggcggcggcggcggcatccccgaccgacctcgcgcccgtgccaccaccggccaccgtcacggcggacggcgacggcggctgggcgtccgacgccttgtccctcgacgacgtgttcctcggcgagctcacggccggcgagccgctgttcccttacgccgagctgttcagcggcttcgccggcgcggcgccggacagcaaggccaccttggagctctcggcgtgctacttcccgaacatggcggagatgtgggcggcctccgaccacgcctacgccaagccacagggtctctgcaacaccctgacataggaggacacgctaaaacctccattgaattcttgcgtagctgcgaacgcaacggcgatcgatcgatgcgtcgccacttgctactagcataattcttgctctcttttttttttcaatttttttctcttcttcgagtggcccattctctagctggcgttttctcgtgtattatgagtgatcgattattacatgtaaattaatccatagatgtatctgcactgatccaaattctccagc</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0553400, RefSeq:Os05g0553400