Difference between revisions of "Os05g0580500"

From RiceWiki
Jump to: navigation, search
(Expression)
(Annotated Information)
Line 5: Line 5:
 
===Function===
 
===Function===
 
OsRad21-4 is a relatively hydrophilic protein and contains the entire Pfam04825 and Pfam04824 domains (spanning amino acids 1–115 and 554–608, respectively) (Figure 2A), of which Pfam04825 is highly conserved in all known members and Pfam04824 present in most of the Rad21/Rec8 family.[1,2] The two domain regions are spaced by a long linker sequence (amino acids 116-553). This linker sequence contains a potential nuclear targeting motif at positions 272–279 (KRKKRRKD), 2 separase recognition sites at 411–421 (ADDIEKLRGNT) and 420–430 (NTSGEYGRDYD) and a PEST motif at 511– 534 (RLSDVGPTPDLLEEIEPTQTPYEK) (Figure 2A). These motifs  are proposed to be implicated in function regulation in cohesion establishment and disassociation [1,3]. In rice, OsRad21-4 is required for homologous pairing and segregation. It might be responsible mainly for sister chromatid-arm cohesion and to a lesser extent or not at all for centromere cohesion. In addition, OsRad21-4 is required for chromosome condensation. OsRad21-4 was essential to meiosis.
 
OsRad21-4 is a relatively hydrophilic protein and contains the entire Pfam04825 and Pfam04824 domains (spanning amino acids 1–115 and 554–608, respectively) (Figure 2A), of which Pfam04825 is highly conserved in all known members and Pfam04824 present in most of the Rad21/Rec8 family.[1,2] The two domain regions are spaced by a long linker sequence (amino acids 116-553). This linker sequence contains a potential nuclear targeting motif at positions 272–279 (KRKKRRKD), 2 separase recognition sites at 411–421 (ADDIEKLRGNT) and 420–430 (NTSGEYGRDYD) and a PEST motif at 511– 534 (RLSDVGPTPDLLEEIEPTQTPYEK) (Figure 2A). These motifs  are proposed to be implicated in function regulation in cohesion establishment and disassociation [1,3]. In rice, OsRad21-4 is required for homologous pairing and segregation. It might be responsible mainly for sister chromatid-arm cohesion and to a lesser extent or not at all for centromere cohesion. In addition, OsRad21-4 is required for chromosome condensation. OsRad21-4 was essential to meiosis.
[[File:F22.png|200px|thumb|left|替换文字]]
+
[[File:F22.png|200px|thumb|left|Figure2(A)]]
  
 
===Expression===
 
===Expression===
OsRad21-4 is present in the rice genome as a single-copy gene. The mRNA and protein of OsRad21-4 were expressed preferentially in young flowers where the pollen mother cells (PMCs) were in pre-meiotic stages. OsRAD21-4 cDNA cloned here is 2133 bp long and has a 5' UTR of 54 bp, a 3' UTR of 255 bp and an ORF of 1824 bp encoding a deduced polypeptide of 608 amino acids (OsRad21-4). OsRad21-4 has a calculated molecular mass of 68.5 kDa and an isoelectric point (pI) of 5.45. The protein is a nucleus-localizing protein.(Figure 2B)[[File:F23.png|200px|thumb|left|替换文字]] As shown in Figure 3A, OsRad21-4 was expressed preferentially in flowers, weakly in leaves and barely in buds and roots. Furthermore, OsRad214 was expressed dominantly just before the premeiotic stage of PMCs. (Figure 3C) This gene should function in premeiotic and meiotic PMCs, which is consistent with this notion that meiotic cohesion is established at the pre-meiotic S phase. (Figur 4)[(Watanabe et al.,2001)4]
+
OsRad21-4 is present in the rice genome as a single-copy gene. The mRNA and protein of OsRad21-4 were expressed preferentially in young flowers where the pollen mother cells (PMCs) were in pre-meiotic stages. OsRAD21-4 cDNA cloned here is 2133 bp long and has a 5' UTR of 54 bp, a 3' UTR of 255 bp and an ORF of 1824 bp encoding a deduced polypeptide of 608 amino acids (OsRad21-4). OsRad21-4 has a calculated molecular mass of 68.5 kDa and an isoelectric point (pI) of 5.45. The protein is a nucleus-localizing protein.(Figure 2B)[[File:F23.png|200px|thumb|left|Figure2(B)]] As shown in Figure 3A, OsRad21-4 was expressed preferentially in flowers, weakly in leaves and barely in buds and roots. Furthermore, OsRad214 was expressed dominantly just before the premeiotic stage of PMCs. (Figure 3C) This gene should function in premeiotic and meiotic PMCs, which is consistent with this notion that meiotic cohesion is established at the pre-meiotic S phase. (Figur 4)[(Watanabe et al.,2001)4]
[[File:F3A.png|200px|thumb|left|Figure3(A)]][[File:F3C.png|200px|thumb|left|替换文字]][[File:F4.png|200px|thumb|left|替换文字]]
+
[[File:F3A.png|200px|thumb|left|Figure3 (A)]][[File:F3C.png|200px|thumb|left|Figure3(C)]][[File:F4.png|200px|thumb|left|Figure4]]
  
 
===Evolution===
 
===Evolution===

Revision as of 15:32, 20 May 2014

Please input one-sentence summary here.

Annotated Information

Rad21/Rec8 is an important component and key regulator of cohesins. OsRAD21-4, a RAD21-like gene from rice Zhonghua 10 (Oryza sativa L. ssp.japonica), is a single-copy gene in the rice genome and essential for efficient meiosis.

Function

OsRad21-4 is a relatively hydrophilic protein and contains the entire Pfam04825 and Pfam04824 domains (spanning amino acids 1–115 and 554–608, respectively) (Figure 2A), of which Pfam04825 is highly conserved in all known members and Pfam04824 present in most of the Rad21/Rec8 family.[1,2] The two domain regions are spaced by a long linker sequence (amino acids 116-553). This linker sequence contains a potential nuclear targeting motif at positions 272–279 (KRKKRRKD), 2 separase recognition sites at 411–421 (ADDIEKLRGNT) and 420–430 (NTSGEYGRDYD) and a PEST motif at 511– 534 (RLSDVGPTPDLLEEIEPTQTPYEK) (Figure 2A). These motifs are proposed to be implicated in function regulation in cohesion establishment and disassociation [1,3]. In rice, OsRad21-4 is required for homologous pairing and segregation. It might be responsible mainly for sister chromatid-arm cohesion and to a lesser extent or not at all for centromere cohesion. In addition, OsRad21-4 is required for chromosome condensation. OsRad21-4 was essential to meiosis.

Figure2(A)

Expression

OsRad21-4 is present in the rice genome as a single-copy gene. The mRNA and protein of OsRad21-4 were expressed preferentially in young flowers where the pollen mother cells (PMCs) were in pre-meiotic stages. OsRAD21-4 cDNA cloned here is 2133 bp long and has a 5' UTR of 54 bp, a 3' UTR of 255 bp and an ORF of 1824 bp encoding a deduced polypeptide of 608 amino acids (OsRad21-4). OsRad21-4 has a calculated molecular mass of 68.5 kDa and an isoelectric point (pI) of 5.45. The protein is a nucleus-localizing protein.(Figure 2B)
Figure2(B)
As shown in Figure 3A, OsRad21-4 was expressed preferentially in flowers, weakly in leaves and barely in buds and roots. Furthermore, OsRad214 was expressed dominantly just before the premeiotic stage of PMCs. (Figure 3C) This gene should function in premeiotic and meiotic PMCs, which is consistent with this notion that meiotic cohesion is established at the pre-meiotic S phase. (Figur 4)[(Watanabe et al.,2001)4]
Figure3 (A)
Figure3(C)
Figure4

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os05g0580500

Description

Rad21/Rec8 like protein, N-terminal domain containing protein

Version

NM_001062961.1 GI:115465652 GeneID:4339720

Length

7262 bp

Definition

Oryza sativa Japonica Group Os05g0580500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:28971202..28978463

Sequence Coding Region

28971255..28971307,28971498..28971566,28971665..28971723,28971819..28971863,28971950..28971969
,28972078..28972154,28973352..28973448,28973606..28973687,28973767..28973845
,28973955..28974118,28974803..28974846,28974927..28975082,28975179..28975347
,28975463..28975530,28975642..28975789,28975853..28975940,28976938..28977065
,28977165..28977249,28977333..28977445,28978161..28978243

Expression

GEO Profiles:Os05g0580500

Genome Context

<gbrowseImage1> name=NC_008398:28971202..28978463 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:28971202..28978463 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgttctactcgcaccagctcctcgcgcggaaggctccgctcggccagatatggatggcggcgacgcttcactcgaagatcaaccggaagcggcttgacaagctcgacatcatcaaaatctgtgaggagattttgaacccgtcggtacccatggcactaaggctctccggaattctcatgggtggtgtggcgatcgtgtacgagaggaaggtgaaggctctgtatgatgatgtgtctcggtttctgattgagatcaacgaggcatggcgggtcaagccagtcgcagaccccaccgtacttcccaagggcaaaacccaagccaagtatgaagcagtaacactgccagagaatatcatggatatggatgtggagcagcccatgcttttctcagaggctgatactacaaggttccggggaatgcgtttggaggatttggatgaccaatacattaatgtcaacctagacgatgatgacttctcgcgcgctgagaatcatcaccaagctgatgcagaaaatatcaccctggctgataatttcgggtctgggcttggagagactgatgtgttcaatcgttttgagagattcgacataacagatgatgatgcaactttcaatgtcactcctgatggacacccacaggttccaagtaatctggttccttctccacctaggcaggaagactctcctcagcaacaagaaaaccatcatgctgcctcatcccctcttcacgaagaagctcaacaagggggggcatctgtaaaaaatgagcaagagcagcagaagatgaagggtcagcaacctgctaaatcatcaaagagaaaaaaacgtaggaaagatgatgaggtgatgatggataacgaccagataatgatcccaggaaatgtatatcaaacatggctgaaggatccatcaagcctcattaccaaaaggcacagaatcaacagtaaagttaatcttattcggtcaatcaagataagagacctcatggacttgcccctcgtttctctaatatcttccttggagaagtcacccttagaattttattatcctaaggaacttatgcagctttggaaggaatgtactgaagtcaagtccccaaaagctccatcttcaggagggcagcagtcatcatcaccagaacaacagcaaagaaacttgcctcctcaggcatttccaacccagcctcaggttgataatgacagggaaatgggatttcacccagtggactttgcagatgacatcgaaaaactccgaggaaacactagtggggaatatggaagagattatgatgcttttcacagtgatcatagtgttactcctggaagtcctgggctaagtcgcaggtctgcttcaagctctggtggctctggacggggatttacgcagttggatccagaagtacagttgccatccggaaggtccaagaggcagcattcatctggaaaaagctttgggaacctcgatccagttgaagaagaattcccattcgagcaagaacttagagatttcaagatgagaaggctttcagatgttgggccaactccagacctgctggaagaaatcgaacctactcaaaccccatatgaaaagaaatccaatcctatcgaccaggtcacacaatcaatccactcgtacctcaagctacactttgacaccccaggggcctcacagtctgaatcattaagtcagctagcacatgggatgactacagcaaaggctgcccgactcttctatcaagcatgcgttttagcaactcatgattttatcaaggttaaccagctggaaccatacggagacatcttgatctcgaggggaccaaagatgtga</cdnaseq>

Protein Sequence

<aaseq>MFYSHQLLARKAPLGQIWMAATLHSKINRKRLDKLDIIKICEEI LNPSVPMALRLSGILMGGVAIVYERKVKALYDDVSRFLIEINEAWRVKPVADPTVLPK GKTQAKYEAVTLPENIMDMDVEQPMLFSEADTTRFRGMRLEDLDDQYINVNLDDDDFS RAENHHQADAENITLADNFGSGLGETDVFNRFERFDITDDDATFNVTPDGHPQVPSNL VPSPPRQEDSPQQQENHHAASSPLHEEAQQGGASVKNEQEQQKMKGQQPAKSSKRKKR RKDDEVMMDNDQIMIPGNVYQTWLKDPSSLITKRHRINSKVNLIRSIKIRDLMDLPLV SLISSLEKSPLEFYYPKELMQLWKECTEVKSPKAPSSGGQQSSSPEQQQRNLPPQAFP TQPQVDNDREMGFHPVDFADDIEKLRGNTSGEYGRDYDAFHSDHSVTPGSPGLSRRSA SSSGGSGRGFTQLDPEVQLPSGRSKRQHSSGKSFGNLDPVEEEFPFEQELRDFKMRRL SDVGPTPDLLEEIEPTQTPYEKKSNPIDQVTQSIHSYLKLHFDTPGASQSESLSQLAH GMTTAKAARLFYQACVLATHDFIKVNQLEPYGDILISRGPKM</aaseq>

Gene Sequence

<dnaseqindica>54..106#297..365#464..522#618..662#749..768#877..953#2151..2247#2405..2486#2566..2644#2754..2917#3602..3645#3726..3881#3978..4146#4262..4329#4441..4588#4652..4739#5737..5864#5964..6048#6132..6244#6960..7042#cagcgcctccactctcactcgctcatccattccctccctcctcacgatcgagaatgttctactcgcaccagctcctcgcgcggaaggctccgctcggccagatatggtgggtttgcttcgctctccgctcctctcgatcgcgtcctttcggcttctcttctcatgcgccgttctgcggtgctccgttctatattgttttctgcgatttctctgctcgttccgctccgaaatccgaatgttcgccacttggttggagttgattaggccgctgattactccgcttttttttttcgcaggatggcggcgacgcttcactcgaagatcaaccggaagcggcttgacaagctcgacatcatcaaaatctggtgagcgaattagtccgaatccagttgtctctgatttcttcgtttcgaacttgacggttttttttggggggattttgtgcgtgtggtttttgggttagtgaggagattttgaacccgtcggtacccatggcactaaggctctccggaattctcatgggtgagtccagtttgcttgttgtctccatagttccgatcgcatttgtttggtgatattttctgatgtgggtgcttgcgtcgtgggagtgtgagtaggtggtgtggcgatcgtgtacgagaggaaggtgaaggctctgtatggtgagttgctccctgattgcttctcttttgtttccattttttttggattcgttatagactcaaactgtgtgagatcttcttcgcagatgatgtgtctcggtttctggtaaaattcgagttcgattttcacctaattttggtgcctcctccttgatccatttgcctgtctatgctaacatggttcagattacgcttgtactaactcctcacacagattgagatcaacgaggcatggcgggtcaagccagtcgcagaccccaccgtacttcccaagggcaaaacccaagccaagtaagtgccctctttgtttccatgaccttctaggactagaagtttctagatgttctgtgcacggttttgggttcgagggaagattgaagaacatgctattatgttggtgaccgaggggagtttgcttttgtttccctgctgccagggattgtgagtttgtgtgtgattttcaccatccgatgctaatctgatggactcgtcatttgacacagttgcaagttttgatatgtcatcagcttacttggttctgattagaacatgctgcatctgtgtaatgttgattttatgatgatactatctccttgcagcatagtacattgttatgttttcagatgtacctgatgttgtcatatgactgattgttctgttctacctgttgtctattggcggttcatgggaccctgctgttacttgcctcttgttgtcttgctgactttggtagcagccgatgtctgtattatgcaggagtactattctacaaatgatctgtgtttcctggcagcataaatttgtctgtatgttgttccagtatatgtaggtcctctacatttgtagggtgatgaagggcttttgcttccccacagtgtttcctcctctcttaatgaaatgatatacaactctcttgcatattcaagaaaaaaaaactggaagggcattaggcagttaggcaggcattgtcagtgagcgatacatgctttatggggatgaacatttgactttttcttgggtgtcagttactggtgccaagggagcaggtctgagggccgtctggtacttgagaaatgttgctatcttagagtctagggaattccatcacctttgggaaccggaggcaaacatttcttaatcttgtatcatgctcgaaggactgactcttgtgggtgtaccatttccttccattgtggcctgcatctgatatgtaaccatgtggctgtgccatcatccccttgatcccttcggaactatgttcgatagttactgcaatgttcacgtgatgttgatacctgtactgttgcaatgagtttaaccctcttggagtcctggatagttcctctgaatgattgtatcccaagggtcttttcaacttacttttgtaaatagcatagagtgggtataagttggtggatggagaatgatattttgtaccaagagtaaaacagtaatggtttgctcatctaaacttggggcttcatgcaggtatgaagcagtaacactgccagagaatatcatggatatggatgtggagcagcccatgcttttctcagaggctgatactacaaggttccggggaatggtaatccctgtaatatgtatatttcggtggtgtctgattgtatgcattgaaagatggcattaagttatgagcaataaccacgagatagtcttgctttcagtctcctgacttttgccagattgtctctattcctctgaaatccgtcatgcatgtgcagcgtttggaggatttggatgaccaatacattaatgtcaacctagacgatgatgacttctcgcgcgctgagaatcatcaccaaggttttcatttcttttcttatgaattactctttgtggttgcttaagaggtgtactttctgactgaaatatgttatctcagctgatgcagaaaatatcaccctggctgataatttcgggtctgggcttggagagactgatgtgttcaatcgttttgagaggtgaagcaaaattttattcttctcttattctaccattcattttttgcacttcttgttccttattttggccagtacaattattcattgagcaatgttacaatgtcaccagattcgacataacagatgatgatgcaactttcaatgtcactcctgatggacacccacaggttccaagtaatctggttccttctccacctaggcaggaagactctcctcagcaacaagaaaaccatcatgctgcctcatcccctcttcacgaagaagctcaacaaggtcaattcaagcacatggtttggtctatttgatcctaaatttggaaagggtactatcatcctgtaaatcgggattttttttccagtttccatgccaaaagacaacaattctcatctctgttttttagcatgccacagatgcaaatgatatttcaaacaagtaaaacttccatccaaatatatctcagtgaatttatgatttgatgtagtttcttcagggatatgaacttgatggttatgtcaatatctcttaacagctagatattctatcttatcatatactctgctatattatgttggttaagaagctaaaagttcactcatcatctcctgttgcctttctacatttccaacggttggattttcgcgaggctaggtagagatgctgagcgattgccattgaatttgctacatgttatgtcattgaatttggcttttgtcaacgggataataaaacacattgtgtaacttgtcaccattcacactagtttactgactgaaattcaatttatattatatttgaatcttttctacttgctaaacaagacttgcatatagcctcttcctcgtgactatctgtacttcagtttgctatatctgatataagtgctggacatggtttgggtacattaatatgtgccatagtgcaagtgccttgttgcaattactgacaacttttctgcagggggggcatctgtaaaaaatgagcaagagcagcagaagatgaaggtttgtgatcaagcgagccgttagcttcaggaacatctagatgaagaagataattgttttgtttgatattgtttaaccagggtcagcaacctgctaaatcatcaaagagaaaaaaacgtaggaaagatgatgaggtgatgatggataacgaccagataatgatcccaggaaatgtatatcaaacatggctgaaggatccatcaagcctcattaccaaaaggcacagaatcaacagtgtatgtaattgctttgattacctaattctgtgtagagttttgtaactatgcagaattttgtgaacatatctgatgttttgccgtgtaatattgcagaaagttaatcttattcggtcaatcaagataagagacctcatggacttgcccctcgtttctctaatatcttccttggagaagtcacccttagaattttattatcctaaggaacttatgcagctttggaaggaatgtactgaagtcaagtccccaaaagctccatcttcaggttactacacaatttgtagttttctttcacctttctggatcaccaagggaactgtaagttttttataatttaatctgctaagttcgaactgaaaaggttgcaatcttttttaaaggagggcagcagtcatcatcaccagaacaacagcaaagaaacttgcctcctcaggcatttccaacccaggttatttctaaatttatatgtttatggaaatgatttatgctagcttttcctattgagctgtaacatttacattcattcttgaacttgtctgataagtggttcaatttgcagcctcaggttgataatgacagggaaatgggatttcacccagtggactttgcagatgacatcgaaaaactccgaggaaacactagtggggaatatggaagagattatgatgcttttcacagtgatcatagtgttactcctggaagtcctggtaagtacaaaaaacaatatattttatttatttagacactgaatgacatcagtcctgctgcagggctaagtcgcaggtctgcttcaagctctggtggctctggacggggatttacgcagttggatccagaagtacagttgccatccggaaggtgagtgttgattaatagcaaccttcactagttttctgaaatatgacttgttcctggaataaataaaaagttatccgtgcaaacttttgaagatgcatgtctttatactggagcctctttggtttatgttccaaagcatcgaagtggttagttgtcttattgatgaagtgttaggcaagaagaaaaggaaacggagattgttaccccccccctccagcggtaaccgctgaaaaccacgtgaaattcgtcctcaaatatttgaattaaaaatcggcggttttgcgttttcggcacagtaaccgcgatattcgcgcggttactgccaattgtgtagcagaatagaaacactcttaaaaaagtttaaaaaagcacttaaatgtgtgtagaaattggggataattagaagaatatataggatacttgcaaacctaacttttgggtgtaaaatacaaaaattctgcatgacattttctatgttatggacttcgaagcaattcaacatttcgtagcataataattcaacaacaacaattcaacaacctcacatttgaaagcatgtgccgagagagagcgatagagatagatgagaggacctaggagatatttttcccacttatgggacttaatgggccagataaacagtgcaactgtgcaacctaaggtccattacatttttcttttttccattttctaatgaacattcggttttaccctcaaatttgaatttatcttactctttttcaaaaaatttcttcactgtctaccactacaaatcaagaagtttttttatttgtttggaattttgaatttgggcaaaatttatcaaaccctaccaccggtaacccttactgtacccccgcggtaagcgcggttaccggtggtaagggaaaccctggtctaggctacttgactatcaactatcaagtggcagcttcctatctatggtccttctattttcatagaggtcttagtacaactgcgtgaggtcattgaacaggtccaagaggcagcattcatctggaaaaagctttgggaacctcgatccagttgaagaagaattcccattcgagcaagaacttagagatttcaagatgagaaggctttcagatgttgggccaactccaggttgacttcttttcagtccttatttcaaatgattctatacaaaagtgtggaaatttatttccccgtcatcataccgattaacttttaatttggtcacagacctgctggaagaaatcgaacctactcaaaccccatatgaaaagaaatccaatcctatcgaccaggtcacacaatcaatccactcgtaagtattcaactatacattatgtttgttccacagattacagtagatgtatactctgtgatcatcaaactaaatccatccaggtacctcaagctacactttgacaccccaggggcctcacagtctgaatcattaagtcagctagcacatgggatgactacagcaaaggctgcccgactcttctatcaagcatgcggtatgagttctataatcccaatgcgagtcaacagatgatgcaatcgctagagtaaacataatgttaacatttcatttgctggtttgatggttatttataatttccgtaagttcatttcaacacttgataagccatgtgtacttcctttccatattgcaactttgcaatgaaatattccaaccattgtttcaagttatgatatcaccgaaaccttttaggctcattacgtttttcccaggcttctctcattacattgaccaagtaaatataataagttcactttattagttcatgtagtgttaagggaggaaaacaaatgtgcaatagcactatttcctgagttggataagtgggcaacacctagtttgcttagccatagacagatgttggaaaatcttgaagaagtaccttggaaattcaatcgtacatcattgtggctatgtattttttgtttctttttcagattgtagccatgtttgatggacgagttagtgattttaactatgtcaataatggttatgtttcttttctccctcgatgagagaggatgagggcctaacaccatgtgtgggcaagatcggtgttcacaaaagtttggttagtgttttatattcttagctttactgtttagcgtggcagtttgatgtttttaggtgcttgtatgtgttattattggttcagtacttgtatttactgaggaccctttgttctgcagttttagcaactcatgattttatcaaggttaaccagctggaaccatacggagacatcttgatctcgaggggaccaaagatgtgacatcctaaatgtttaatagttggacaattttctgctgttgtggttcttgcacatctcgtgttatgtatggtgtttaagtttgcacatgaagtttagaaaaacttcgaaggaaggcttgtaggtacgttgtattggggcatgtatttaacactagttttgtgtaggaaagaaattttgtaagtatgctgaatggcttgatagctggtgcaaggttaaagtt</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0580500, RefSeq:Os05g0580500