Difference between revisions of "Os01g0177400"
(→Expression) |
(→References) |
||
| Line 22: | Line 22: | ||
==References== | ==References== | ||
Please input cited references here. | Please input cited references here. | ||
| + | 1. Masao Iwamoto;Seiichiro Kiyota;Atsushi Hanada;Shinjiro Yamaguchi;Makoto Takano | ||
| + | The Multiple Contributions of Phytochromes to the Control of Internode Elongation in Rice | ||
| + | Plant Physiology, 2011, 157(3): 1187-1195 | ||
| + | 2. Hironori Itoh;Miyako Ueguchi-Tanaka;Naoki Sentoku;Hidemi Kitano;Makoto Matsuoka;and Masatomo Kobayashi | ||
| + | Cloning and functional analysis of two gibberellin 3β-hydroxylase genes that are differently expressed during the growth of rice | ||
| + | Proceedings of the National Academy of Sciences, 2001, 98(15): 8909-8914 | ||
==Structured Information== | ==Structured Information== | ||
Revision as of 17:45, 20 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here. D18 CDS 1113 bp, contains three exons, encoding a 370 amino acid composition of protein products. Phytochrome in the regulation of rice section elongation of different levels, such as regulating OsGA3ox2 GA biosynthesis gene expression, the expression of ACO1 section and the elongation of the initial (Iwamoto et al. 2011) Gibberellin 3 beta hydroxylase activity (0016707) GO:
Expression
Please input expression information here. Rice genome library makes use of degenerate primers PCR amplification, filter and cloned into two gibberellin 3 beta OsGA3ox1 and OsGA3ox2 hydroxylase gene.The authors use the GC - MS full range scan and Kovats retention index to test the function of the recombinant fusion protein.Two proteins in GA20 to GA1, GA5 to GA3 and GA44 to GA38 and GA9 to GA4 show hydroxylase activity.In addition, the indirect evidence also suggests that proteins in catalytic GA9 OsGA3ox1 to 2, 3 - dehydro - GA9, GA20 to GA5 (2, 3 - dehydro - GA20) have 2, 3 dehydrogenase activity, in the process of the catalytic GA1 to GA8, GA4 to GA34 plays in the process of 2 beta hydroxylase activity.Molecules and linkage analysis showed that OsGA3ox1 located in chromosome 5 short arm distal, OsGA3ox2 located in chromosome 1 short arm distal D18 seat.OsGA3ox2 and verified by complementary experiments, the correlation of d18 by OsGA3ox2 complementary d18 - AD alleles, gm strains showed normal phenotype.The two genes are characterized by brief expression, including OsGA3ox1 expressed in unopened flower, highest OsGA3ox2 expressed in elongation of blade top (Itoh et al., 2001)
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here. 1. Masao Iwamoto;Seiichiro Kiyota;Atsushi Hanada;Shinjiro Yamaguchi;Makoto Takano
The Multiple Contributions of Phytochromes to the Control of Internode Elongation in Rice Plant Physiology, 2011, 157(3): 1187-1195
2. Hironori Itoh;Miyako Ueguchi-Tanaka;Naoki Sentoku;Hidemi Kitano;Makoto Matsuoka;and Masatomo Kobayashi
Cloning and functional analysis of two gibberellin 3β-hydroxylase genes that are differently expressed during the growth of rice Proceedings of the National Academy of Sciences, 2001, 98(15): 8909-8914
Structured Information
| Gene Name |
Os01g0177400 |
|---|---|
| Description |
GA 3beta-hydroxylase |
| Version |
NM_001048721.1 GI:115434855 GeneID:4323864 |
| Length |
1229 bp |
| Definition |
Oryza sativa Japonica Group Os01g0177400, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:4002659..4003887 |
| Sequence Coding Region |
4002659..4003307,4003415..4003697,4003707..4003887 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:4002659..4003887 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:4002659..4003887 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgccgacgccgtcgcacttgaagaacccgctctgcttcgacttccgggcggcgaggcgggtgccggagacgcacgcgtggccggggctggacgaccacccggtggtggacggcggcggcggcggcggcgaggacgcggtgccggtggtggacgtcggggcgggcgacgcggcggcgcgggcggcggagcagtggggcgcgttccttctggtcgggcacggcgtgccggcggcgctgctgtcgcgcgtcgaggagcgcgtcgcccgcgtgttctccctgccggcgtcggagaagatgcgcgccgtccgcggccccggcgagccctgcggctacggctcgccgcccatctcctccttcttctccaagctcatgtggtccgagggctacaccttctccccttcctccctccgctccgagctccgccgcctctggcccaagtccggcgacgactacctcctcttctgtgacgtgatggaggagtttcacaaggagatgcggcggctagccgacgagttgctgaggttgttcttgagggcgctggggctcaccggcgaggaggtcgccggagtcgaggcggagaggaggatcggcgagaggatgacggcgacggtgcacctcaactggtacccgaggtgcccggagccgcggcgagcgctggggctcatcgcgcacacggactcgggcttcttcaccttcgtgctccagagcctcgtcccggggctgcagctgttccgtcgagggcccgaccggtgggtggcggtgccggcggtggcgggggccttcgtcgtcaacgtcggcgacctcttccacatcctcaccaacggccgcttccacagcgtctaccaccgcgccgtcgtgaaccgcgaccgcgaccgggtctcgctcggctacttcctcggcccgccgccggacgccgaggtggcgccgctgccggaggccgtgccggccggccggagccccgcctaccgcgctgtcacgtggccggagtacatggccgtccgcaagaaggccttcgccaccggcggctccgccctcaagatggtctccaccgacgccgccgccgccgccgacgaacacgacgacgtcgccgccgccgccgacgtccacgcataa</cdnaseq> |
| Protein Sequence |
<aaseq>MPTPSHLKNPLCFDFRAARRVPETHAWPGLDDHPVVDGGGGGGE DAVPVVDVGAGDAAARAAEQWGAFLLVGHGVPAALLSRVEERVARVFSLPASEKMRAV RGPGEPCGYGSPPISSFFSKLMWSEGYTFSPSSLRSELRRLWPKSGDDYLLFCDVMEE FHKEMRRLADELLRLFLRALGLTGEEVAGVEAERRIGERMTATVHLNWYPRCPEPRRA LGLIAHTDSGFFTFVLQSLVPGLQLFRRGPDRWVAVPAVAGAFVVNVGDLFHILTNGR FHSVYHRAVVNRDRDRVSLGYFLGPPPDAEVAPLPEAVPAGRSPAYRAVTWPEYMAVR KKAFATGGSALKMVSTDAAAAADEHDDVAAAADVHA</aaseq> |
| Gene Sequence |
<dnaseqindica>581..1229#191..473#1..181#atgccgacgccgtcgcacttgaagaacccgctctgcttcgacttccgggcggcgaggcgggtgccggagacgcacgcgtggccggggctggacgaccacccggtggtggacggcggcggcggcggcggcgaggacgcggtgccggtggtggacgtcggggcgggcgacgcggcggcgcgggtggcgcgggcggcggagcagtggggcgcgttccttctggtcgggcacggcgtgccggcggcgctgctgtcgcgcgtcgaggagcgcgtcgcccgcgtgttctccctgccggcgtcggagaagatgcgcgccgtccgcggccccggcgagccctgcggctacggctcgccgcccatctcctccttcttctccaagctcatgtggtccgagggctacaccttctccccttcctccctccgctccgagctccgccgcctctggcccaagtccggcgacgactacctcctcttctggtatatatacatatatactctcccatgcattccatgcacatacactctacgtatatatctacctctacgtatatatctacgtattgatctacgtataatatacgcagtgacgtgatggaggagtttcacaaggagatgcggcggctagccgacgagttgctgaggttgttcttgagggcgctggggctcaccggcgaggaggtcgccggagtcgaggcggagaggaggatcggcgagaggatgacggcgacggtgcacctcaactggtacccgaggtgcccggagccgcggcgagcgctggggctcatcgcgcacacggactcgggcttcttcaccttcgtgctccagagcctcgtcccggggctgcagctgttccgtcgagggcccgaccggtgggtggcggtgccggcggtggcgggggccttcgtcgtcaacgtcggcgacctcttccacatcctcaccaacggccgcttccacagcgtctaccaccgcgccgtcgtgaaccgcgaccgcgaccgggtctcgctcggctacttcctcggcccgccgccggacgccgaggtggcgccgctgccggaggccgtgccggccggccggagccccgcctaccgcgctgtcacgtggccggagtacatggccgtccgcaagaaggccttcgccaccggcggctccgccctcaagatggtctccaccgacgccgccgccgccgccgacgaacacgacgacgtcgccgccgccgccgacgtccacgcataa</dnaseqindica> |
| External Link(s) |