Difference between revisions of "Os11g0126900"

From RiceWiki
Jump to: navigation, search
(Expression)
(Expression)
Line 7: Line 7:
  
 
===Expression===
 
===Expression===
* ''OsNAC10'' is expressed predominantly in roots and panicles.[[File:finger1.jpg]]
+
* ''OsNAC10'' is expressed predominantly in roots and panicles.[[File:os1.jpg]]
  
 
* The expression of ''OsNAC10'' is induced by drought, high salinity, and ABA but not by low temperature.
 
* The expression of ''OsNAC10'' is induced by drought, high salinity, and ABA but not by low temperature.

Revision as of 08:01, 21 May 2014

Please input one-sentence summary here.

The rice Os11g0126900 was reported as NAC (an acronym for NAM [No Apical Meristem], ATAF1-2, and CUC2 [Cup-Shaped Cotyledon]) domain gene, OsNAC10,in 2010 by Korean researchers.

Annotated Information

Function

OsNAC10 plays important role in enhancing stress tolerance when overexpressed in rice.

Expression

  • OsNAC10 is expressed predominantly in roots and panicles.Os1.jpg
  • The expression of OsNAC10 is induced by drought, high salinity, and ABA but not by low temperature.
  • 34 root-specific and 40 leaf-specific target genes were up-regulated when OsNAC10 was overexpressed in transgenic plants.Transcript levels of seven root-specific target genes [P450, Zn-finger, HAK5, 2OG-Fe(Ⅱ),NCED, NAC, and KUP3] were increased in transgenic roots. Expression of two leaf-specific target genes, LRR and Peroxidase, was found to be OsNAC10 dependent only in GOS2:OsNAC10 leaves but not in RCc3:OsNAC10 leaves. Expression of two common target genes, F-box and Muts4, was found to be OsNAC10 dependent both in roots and leaves of the GOS2:OsNAC10 plants.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

  • School of Biotechnology and Environmental Engineering, Myongji University, Yongin 449-728, Korea.
  • National Academy of Agricultural Science, Suwon 441–707, Korea.
  • School of Agricultural Biotechnology, Seoul National University, Seoul 151–921, Korea.
  • CropDesign NV, B–9052 Ghent, Belgium

References

1. Jeong, J. S., Kim, Y. S.,Baek, K. H.,et al. (2010). "Root-specific expression of OsNAC10 improves drought tolerance and grain yield in rice under field drought conditions." Plant Physiol 153(1): 185-197.

Structured Information

Gene Name

Os11g0126900

Description

Similar to NAC domain transcription factor

Version

NM_001072159.1 GI:115483930 GeneID:4349648

Length

2046 bp

Definition

Oryza sativa Japonica Group Os11g0126900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 11

Location

Chromosome 11:1215803..1217848

Sequence Coding Region

1216006..1216177,1216305..1216612,1216879..1216914

Expression

GEO Profiles:Os11g0126900

Genome Context

<gbrowseImage1> name=NC_008404:1215803..1217848 source=RiceChromosome11 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008404:1215803..1217848 source=RiceChromosome11 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgccgagcagcggcggcgccatgcctgcccttccaccaggcttccgcttccaccccaccgacgaggagctcatcgttcactacctcatgaaccaggccgcctccgtcaagtgccccgtgccaatcatcgccgaggtcaacatctacaagtgcaacccatgggaccttcctggtaaggctttgttcggcgagaacgaatggtacttcttcagcccgagggaccgcaagtaccccaacggcgctcgccccaaccgcgccgccggctcggggtactggaaggccaccggcaccgacaagtccatcctctccactccgaccagcgacaacatcggcgtcaagaaggccctcgtcttctacaagggcaagcctcccaagggcgtcaagaccgactggatcatgcacgagtaccgtctcaccggcacatcagctaacagcaccaccaccacaaagcagcgtagagcgtcatccatgaccatgaggaatccacaagaagagcaacgacttcaattcctctga</cdnaseq>

Protein Sequence

<aaseq>MPSSGGAMPALPPGFRFHPTDEELIVHYLMNQAASVKCPVPIIA EVNIYKCNPWDLPGKALFGENEWYFFSPRDRKYPNGARPNRAAGSGYWKATGTDKSIL STPTSDNIGVKKALVFYKGKPPKGVKTDWIMHEYRLTGTSANSTTTTKQRRASSMTMR NPQEEQRLQFL</aaseq>

Gene Sequence

<dnaseqindica>204..375#503..810#1077..1112#atttcaatccttcctcttccttagcttattagcttccttccttcactagtgccagttttcctcctacctaatctaagctagccaggtcgtcatcttcttccttcagctcacgctgaccaaacaccatctgttattctgtttgtttgtttttttaaaaaaaagaaaaaaaatctagctaggcgagccgattgaaggagctgagcatgccgagcagcggcggcgccatgcctgcccttccaccaggcttccgcttccaccccaccgacgaggagctcatcgttcactacctcatgaaccaggccgcctccgtcaagtgccccgtgccaatcatcgccgaggtcaacatctacaagtgcaacccatgggaccttcctggtaactaactaactaatcaccatacatatatatactatccatgtatcaattaaactcgatcaaattaatgccttcaaactgaccaaatttaactttgggctttgaaaatggatatgggatgttgcaggtaaggctttgttcggcgagaacgaatggtacttcttcagcccgagggaccgcaagtaccccaacggcgctcgccccaaccgcgccgccggctcggggtactggaaggccaccggcaccgacaagtccatcctctccactccgaccagcgacaacatcggcgtcaagaaggccctcgtcttctacaagggcaagcctcccaagggcgtcaagaccgactggatcatgcacgagtaccgtctcaccggcacatcagctaacagcaccaccaccacaaagcagcgtagagcgtcatccatgaccatgagggtgagattaattacttaactaatttagttttctcttcgtcgtacgtcttgtttgaaagctacttgttgtttggcataaagaaggagcaacgtgcatgttgctcttagttaactcagtacaaagtcaaatgagttgatgttgattgagcttgttttattcttggtatatattttattttttagaaaagggttaaagtttgcacgcttctaattattgtttactgcatttgtgattgtccatcagctggacgactgggtgctgtgcagaatccacaagaagagcaacgacttcaattcctctgaccaacacgaccaagaacccgaggaatcaaccgtcgaacagcttgaagacatccatgacaacaactcctctgaacaacctccagctccagctgacatgaacaaccaacagtcagatttccagcccatgacggcgatgagcatgagcaagtcatgctccctcaccgatctcctcaacaccatcgactgcgccgcgctctcgcagtttctcctcgacggctcatccgacgccatcgctgagcctcctgctcctcccagccccctaatatacacaacacctcatccaaattaccaaacactaaactataacattaacagcaacagcagcatgccacacgccttcgagtcacgcctagatcatcacgatggttacgttaacaattataatgttaatggcctgaggaggaagagaatgatggcgtgtagtgcaacttcctttgatgatggcagcagcagcaatgactttgtgcatgccgttgtcaagaaaccgcagctgctgccaagtgattcgaggggtagtggttttggaggaggttactgcaaccagcagctttcagagactgcgactggctttcagtttcagaacggcaatctgctgagccatccatttcctctgaacaatcatctgcagatgcagtagtaggcgtctagatcccgtttaccgatcgatctgaagagaggtgaattaatttcaacgaatgaaactacagattcagagaggaagatactgattgttccatttgtgatttattttgaggagttgcatgggcagatagacaaacagacggaattcttgatgtaaccgatgcaaggaaagattcagatttcttcctatggcattaatttgtgagtttttttttgttttcattttcatgtacaagaatgtaaattataaatggtaatatcgtgcaagctagtactcaagccaatttatatg</dnaseqindica>

External Link(s)

NCBI Gene:Os11g0126900, RefSeq:Os11g0126900