Difference between revisions of "Os04g0350700"

From RiceWiki
Jump to: navigation, search
(An-1 expression level changes underlying the panicle phenotypes)
(An-1 expression level changes underlying the panicle phenotypes)
Line 13: Line 13:
 
During spikelet development, An-1 transcripts were first detected at the two rudimentary glume primordia and two empty glume primordia, next at the lemma and palea primordia, and then at the stamen and carpel primordia .An-1 expression increased gradually at the apices of lemma primordia.Then, An-1 expression strongly increased in awn primordia of Sp6, was maintained until Sp8e, and gradually faded during the Sp8l stage.
 
During spikelet development, An-1 transcripts were first detected at the two rudimentary glume primordia and two empty glume primordia, next at the lemma and palea primordia, and then at the stamen and carpel primordia .An-1 expression increased gradually at the apices of lemma primordia.Then, An-1 expression strongly increased in awn primordia of Sp6, was maintained until Sp8e, and gradually faded during the Sp8l stage.
  
== '''An-1 expression level changes underlying the panicle phenotypes''' ==
+
An-1 expression level changes underlying the panicle phenotypes
  
 
qRT-PCR analysis showed that An-1 expression of young panicles was increased twofold in NIL-An-1(a near-isogenic line that contained only a 120-kb W1943 genomic fragment of the An-1 locus in GLA4 and exhibited a stable and similar awn length and awn rate) compared with that in GLA4 (Guangluai4). For complementary plants, An-1 expression increased nearly 40- to 45-fold in CPL-1(An-1 complementation plants) and CPL-2 plants compared with that in Nipponbare .In RNAi plants(An-1 suppression plants), the expression of endogenous An-1gene decreased. The extent of An-1 downregulation was highly correlated with panicle phenotypes in RNAi plants.The qRT-PCR results and panicle phenotypes suggested An-1 expression level was directly proportional to awn length and grain length but inversely proportional to grain number per  panicle.qRT-PCR results and panicle phenotypes suggested An-1 expression level was directly proportional to awn length and grain length but inversely proportional to grain number per panicle.
 
qRT-PCR analysis showed that An-1 expression of young panicles was increased twofold in NIL-An-1(a near-isogenic line that contained only a 120-kb W1943 genomic fragment of the An-1 locus in GLA4 and exhibited a stable and similar awn length and awn rate) compared with that in GLA4 (Guangluai4). For complementary plants, An-1 expression increased nearly 40- to 45-fold in CPL-1(An-1 complementation plants) and CPL-2 plants compared with that in Nipponbare .In RNAi plants(An-1 suppression plants), the expression of endogenous An-1gene decreased. The extent of An-1 downregulation was highly correlated with panicle phenotypes in RNAi plants.The qRT-PCR results and panicle phenotypes suggested An-1 expression level was directly proportional to awn length and grain length but inversely proportional to grain number per  panicle.qRT-PCR results and panicle phenotypes suggested An-1 expression level was directly proportional to awn length and grain length but inversely proportional to grain number per panicle.

Revision as of 12:36, 21 May 2014

Please input one-sentence summary here.

Annotated Information

Function

An-1 that encodes a basic helix-loop-helix (bHLH) protein and regulates the long-awn trait in wild rice.An-1 is intensely expressed at the apex of the lemma primordia, specifically causing continuous cell division to form a long awn. Upregulation of An-1 expression could induce long awns and grain elongation as well as reduce grain number per panicle in awnless cultivated rice.population genetic analysis of wild and cultivated rice showed a significant reduction in nucleotide diversity of the An-1 locus and revealed that the An-1 locus was a major target for artificial selection.

Expression

Expression pattern of An-1

During spikelet development, An-1 transcripts were first detected at the two rudimentary glume primordia and two empty glume primordia, next at the lemma and palea primordia, and then at the stamen and carpel primordia .An-1 expression increased gradually at the apices of lemma primordia.Then, An-1 expression strongly increased in awn primordia of Sp6, was maintained until Sp8e, and gradually faded during the Sp8l stage.

An-1 expression level changes underlying the panicle phenotypes

qRT-PCR analysis showed that An-1 expression of young panicles was increased twofold in NIL-An-1(a near-isogenic line that contained only a 120-kb W1943 genomic fragment of the An-1 locus in GLA4 and exhibited a stable and similar awn length and awn rate) compared with that in GLA4 (Guangluai4). For complementary plants, An-1 expression increased nearly 40- to 45-fold in CPL-1(An-1 complementation plants) and CPL-2 plants compared with that in Nipponbare .In RNAi plants(An-1 suppression plants), the expression of endogenous An-1gene decreased. The extent of An-1 downregulation was highly correlated with panicle phenotypes in RNAi plants.The qRT-PCR results and panicle phenotypes suggested An-1 expression level was directly proportional to awn length and grain length but inversely proportional to grain number per panicle.qRT-PCR results and panicle phenotypes suggested An-1 expression level was directly proportional to awn length and grain length but inversely proportional to grain number per panicle.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os04g0350700

Description

Similar to Phytochrome-interacting factor 4 (Basic helix-loop-helix protein 9) (bHLH9) (AtbHLH009) (Short under red-light 2)

Version

NM_001059067.2 GI:297602518 GeneID:4335553

Length

3599 bp

Definition

Oryza sativa Japonica Group Os04g0350700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:16752716..16756314

Sequence Coding Region

16753371..16753423,16753641..16753881,16754006..16754077,16754255..16754323,16755156..16755221
,16755416..16755589,16755668..16755784

Expression

GEO Profiles:Os04g0350700

Genome Context

<gbrowseImage1> name=NC_008397:16752716..16756314 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:16752716..16756314 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgaaccccaccaccgccgccgccgccgaccaaccatccaagccctccgccgccgccgccgcccggaagcgcaagtcgtcggcgaagcccaaggcctcgtcctcatccttacccacggccacggcgacgacgaacgcgagcccgaagcggtccaaggtcgccgccggcgccggagacgacggcgacgccgacgccgacgcggcggaggagaagccggagccagccaaagactacatccatgtgagggcgaggcgggggcaagccaccgatagccatagcctcgccgagagggtgaggagggagaggataagcgagaggatgaagcttctgcagtcgctcgtgccaggctgcaacaagatcaccggcaaggctctcatgctggacgagatcatcaactatgtgcagtcgctgcagcgtcaggtcgagtttttgtccatgaagttggcgaccatgaatcctcagctggactttgacagccattacatgccttccaaagatatgagccatatgccagtacccgcatacccgtcaagcgatccgaccaccaccaccgcgttctcctacaccggctcacccgccactgctgatccattcaccgtctacaactgctgggagctcgacctccacaccgctatgcaaatgggagccaccaccggactcagccaagacggtccaatcgcaacgatggcaccctctccctcgccattgccgcaccatcctcctcttcacggcttctacggggggcagcagcagcaggggacgacagtaaaccacatgaaggccgagccataa</cdnaseq>

Protein Sequence

<aaseq>MNPTTAAAADQPSKPSAAAAARKRKSSAKPKASSSSLPTATATT NASPKRSKVAAGAGDDGDADADAAEEKPEPAKDYIHVRARRGQATDSHSLAERVRRER ISERMKLLQSLVPGCNKITGKALMLDEIINYVQSLQRQVEFLSMKLATMNPQLDFDSH YMPSKDMSHMPVPAYPSSDPTTTTAFSYTGSPATADPFTVYNCWELDLHTAMQMGATT GLSQDGPIATMAPSPSPLPHHPPLHGFYGGQQQQGTTVNHMKAEP</aaseq>

Gene Sequence

<dnaseqindica>2892..2944#2434..2674#2238..2309#1992..2060#1094..1159#726..899#531..647#tcccctctcctctctctctctcttctctcctcctccactctcccacgccgccgacgacgacgatggccgacgagcacttcttccccgccggcgactacttctccacctcctcgtccggcgccggcacgggcggtgcgggcgcgttgctgcccgccgcggcgtacgggacgatgacgatgatgccgccgtgggcagtggcggccgccgagcagatgatgatgatggcgccggcggcggccgcggcggagttcgactccgcgctcagctccctcgtgtcgtctccgcagggcggcggcggcggcgacgagatggcggccatcggcgacctcatcggccggcttgggagcatctgcagccacggcgggccagcgccaacaactcctgctacagcacgccgctcagctccccgccgcgggccgccccgccgccgccgttccgtggcttagccgccgcggcggcaggctgtcccgtgtctccagcagcaagtccctccgggcgccgccgcggcattggacagctccgaggccgacatgaaccccaccaccgccgccgccgccgaccaaccatccaagccctccgccgccgccgccgcccggaagcgcaagtcgtcggcgaagcccaaggcctcgtcctcatccttacccacggtacgacaccatactccgaccaccgctctccatcacttctccgatctccactgatcaccaaccccatgcacaatgcaggccacggcgacgacgaacgcgagcccgaagcggtccaaggtcgccgccggcgccggagacgacggcgacgccgacgccgacgcggcggaggagaagccggagccagccaaagactacatccatgtgagggcgaggcgggggcaagccaccgatagccatagcctcgccgagagggtaattaatcacctaattaattaaatcctaattagcttttttgcaagtactacactaatcccaaaattaatcacaatgcgagggcaccccctaattgcgcaccgtgttactaattgctctacttattgagttgcaaggacgcttaattattattaaaattttaattagctttgtgttttgtttaatattggtaggtgaggagggagaggataagcgagaggatgaagcttctgcagtcgctcgtgccaggctgcaacaaggtagtatgaacacaaacacactccagcggctaatctcattcttaaatttcctccaaattcatgtatccaaacaagtggcttcttttttttcccgctccaaattacactcaaaatttaaaattctagttttagagtttaattaatatcaaaagcagttgtactaatttgtaatattagaattccgttatacggggcagtactgaaaattagtggtcaaaaatgtattttcgaggacgcgcattaagggggaatagtaacctaacgtacaaaacggacttgcctgtgtggcaataattaagtttaatatatatacaattactttagtttcagtattgcctagagctaggagttggactttttgctactgggatagataaaattaagtaaaaaaataataatcttttttgtaccgaaagtgtgagcactaactgcggtggttagtctatgcagccagtagtaattttgaccgtaatgcatgtaagctactagtagtactcctaagttaagctcccagtggtccaagaggatataataataattgattagttaataatctgagaggctcttgctctgtacttaaactaatcaaaccggctaatcaattgcaaggtcctggtggtttaggtggtgcgcacgattattttagttgccccaattattgccacggtagtgatgccaccgccggtggtcaaatttgggttgaattttaaatttggttgataacttttcttacctttttaaaatttattgctgagtttttttctagatgattgtttattgtttttgttttgttaattagttagcaaataaatgtgaatgttgcggtgtgcagatcaccggcaaggctctcatgctggacgagatcatcaactatgtgcagtcgctgcagcgtcaggtcgaggtaccaatgcaagcatttgctttaatagtgtgctaaatgaacttgttttaatgacaataaatatgttggagaaaaatgttgttgtgttctccttctgtcgtcctagctagctcttatttgaagttatgtatgaaattaagcccaaaagctaaattttgacattggtgtgtctcacagtttttgtccatgaagttggcgaccatgaatcctcagctggactttgacagccattacatgccttccaaagatgtaagtatagcatctgaaaacacttttatctgatctagagagacagttgacacagagtactattacgatattgtccctcaatttgcaaatgttatattcgccgcactcggggtatcattttcagatgagccatatgccagtacccgcatacccgtcaagcgatccgaccaccaccaccgcgttctcctacaccggctcacccgccactgctgatccattcaccgtctacaactgctgggagctcgacctccacaccgctatgcaaatgggagccaccaccggactcagccaagacggtccaatcgcaacgatggcaccctctccctcgccattgccgcaccatcctcctcttcacggcttctacggtaagtgaaatcgaaccaccacatctccttacatccctaacaaattatacatgaatttttaaaaatactcaattttttttttaaaaaaagttcaaaaataagattattttttttactggactacagtagtggagtggtggtggtcatactactccagtacggtaggtttgtttgtccaagtttgttgagtttcgctgttggtggtaattgggcgcaggggggcagcagcagcaggggacgacagtaaaccacatgaaggccgagccataataaatgcggcgacctctccttctgtacatacgcccagccgccgtacgtgtactccgcttttctgctcccatcctgcagcatcagcatcaccagcagcagcaaacccaagctcacaatcattgccatcaaagaagaaagaagaggatgttgtgtgtgactgtgtgtgtggctttgatcatggctttggcttgatcctacaaaagccactatctttttttccgcttttctacccctctgccgtctgtcactgcaggtggggcccagctgcacagggaaggagaaggttttccaaggcttaactttttccagatgcagtgtcatattgtttaggcaaagaacttgttttgatgttgtgatgcttgtaggacagaggagtatatgtgtagtatgtctggaaatggcaaggcaggggagctgtgtgacctttgtgtgtgctggttgcatgccctaactgtagaaaaaaaaaagaggaggattgtgctagtgatgttagtagtggtagtggctttgtaggatttggcatgcatggggatgtatgtactatgtatgtagagattggagaggattttgaaaaacaccttccttttttgtggacattgttttgtatcaagagtactggaatcatcatgcatgcaagaaatgttctttgaacaat</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0350700, RefSeq:Os04g0350700