Difference between revisions of "Os06g0701700"

From RiceWiki
Jump to: navigation, search
(References)
(References)
Line 19: Line 19:
 
==References==
 
==References==
 
[1] T Horie, A Costa1, TH Kim, MJ Han, R Horie, HY Leung, A Miyao, H Hirochika, G An and JI Schroeder. Rice OsHKT2;1 transporter mediates large Na+ influx component into K+-starved roots for growth. The EMBO Journal .2007, 26: 3003–3014.
 
[1] T Horie, A Costa1, TH Kim, MJ Han, R Horie, HY Leung, A Miyao, H Hirochika, G An and JI Schroeder. Rice OsHKT2;1 transporter mediates large Na+ influx component into K+-starved roots for growth. The EMBO Journal .2007, 26: 3003–3014.
 +
 
[2] SB Huang, W Spielmeyer, ES Lagudah and R Munns. Comparative mapping of HKT genes in wheat, barley, and rice, key determinants of Na+ transport and salt tolerance. Journal of Experimental Botany. 2008, 59(4): 927-937.
 
[2] SB Huang, W Spielmeyer, ES Lagudah and R Munns. Comparative mapping of HKT genes in wheat, barley, and rice, key determinants of Na+ transport and salt tolerance. Journal of Experimental Botany. 2008, 59(4): 927-937.
 +
 
[3] X Yao, T Horie, S Xue, HY Leung, M Katsuhara, DE Brodsky,Y Wu and JI Schroeder. Differential Sodium and Potassium Transport Selectivities of the Rice OsHKT2;1 and OsHKT2;2 Transporters in Plant Cells. Plant Physiology. 2010, 152: 341–355.
 
[3] X Yao, T Horie, S Xue, HY Leung, M Katsuhara, DE Brodsky,Y Wu and JI Schroeder. Differential Sodium and Potassium Transport Selectivities of the Rice OsHKT2;1 and OsHKT2;2 Transporters in Plant Cells. Plant Physiology. 2010, 152: 341–355.
  

Revision as of 03:48, 22 May 2014

Please input one-sentence summary here.

Annotated Information

Function

The OsHKT2;1 transporter from rice, previously named OsHKT1, functions as a relatively Na+-selective transporter in heterologous expression systems. Compared with related OsHKT2;1 wild-type control plants, OsHKT2;1-null rice showed remarkably reduced growth, accompanied with a withering of the oldest leaf under low Na+ and K+ starvation conditions. Thus, rice OsHKT2;1 transporter can mediate large Na+ influx component into K+-starved roots, allowing improved growth of rice.

Expression

Rice OsHKT2;1 gene, which locates at the plasma membrane, is mainly expressed in cortex cells in roots and in vascular bundle regions in leaves. In addition, the OsHKT2;1 gene expression in intact roots is controlled by external K+ and Na+ concentrations at the transcriptional and posttranslational levels. Both transcriptional and posttranslational mechanisms monitor and down-regulate the amount of Na+ influx via OsHKT2;1 to prevent Na+ over-accumulation and thus Na+ toxicity.

Evolution

In rice, there are eight HKT-like genes. OsHKT2;1 is the first gene to be discovered and shares 93% identity at the nucleotide level with OsHKT2;2. Moreover, OsHKT2;1 has 73-76% identity at the positions 669-855,1016-1170 and 1366-1502 with OsHKT2;3/4 in rice.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

[1] T Horie, A Costa1, TH Kim, MJ Han, R Horie, HY Leung, A Miyao, H Hirochika, G An and JI Schroeder. Rice OsHKT2;1 transporter mediates large Na+ influx component into K+-starved roots for growth. The EMBO Journal .2007, 26: 3003–3014.

[2] SB Huang, W Spielmeyer, ES Lagudah and R Munns. Comparative mapping of HKT genes in wheat, barley, and rice, key determinants of Na+ transport and salt tolerance. Journal of Experimental Botany. 2008, 59(4): 927-937.

[3] X Yao, T Horie, S Xue, HY Leung, M Katsuhara, DE Brodsky,Y Wu and JI Schroeder. Differential Sodium and Potassium Transport Selectivities of the Rice OsHKT2;1 and OsHKT2;2 Transporters in Plant Cells. Plant Physiology. 2010, 152: 341–355.

Structured Information

Gene Name

Os06g0701700

Description

HKT-type transporter (Sodium ion transporter)

Version

NM_001065021.1 GI:115469773 GeneID:4341971

Length

2264 bp

Definition

Oryza sativa Japonica Group Os06g0701700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:30415942..30418205

Sequence Coding Region

30416168..30416372,30416665..30416886,30417000..30418165

Expression

GEO Profiles:Os06g0701700

Genome Context

<gbrowseImage1> name=NC_008399:30415942..30418205 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:30415942..30418205 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgacgagcatttaccatgatttcattcataacaagctgcagagcttcggaaggatcggtagatattttgttaattttgttgttctagcccatagattcattgccttgcatattcacccattctggattcagttgtcctacttccttctcattagcatcctaggttcagttctattgatgttcctgaagccaagcaacccagaattcagaccaggttacattgacatgctgttcttgtcaacctctgctctgacactttccagcctcatcaccatcgaaatggaggttctctcaagctcacaaattgtggttattacactgctgatgcttctcgggggtgaagtctttgtttctttcctaggcctcatgcttagactgaaccataagcacaacccagagttttcaggggacaaggtcagttcagttcctatcgagcttgatacaatcaactcggcaagcactgtgataagttgtgaagagctgcagctggaagcagcaattcctgaagttccatcttccaccattaaggatttgaagaggagcaagcgcctgaggtggttcttaggatttgtagtcttcagctattttgttgtgatccatgtcgctggctttctgctggttctctggtacataagtcgtgtctcatctgcaaaagctccactgaagaagaaagggatcaacattgcactcttctcattctcggtcacagtctcctcgtttgcgaatgtggggctcgtgccgacgaatgagaacatggcaatcttctccaagaacccgggcctcctcctcctgttcatcggccagattcttgcaggcaatacactttaccctctcttcctaaggctattgatatggttcctggggaaggtgaccaagttgagagaactgaagctcatgatcaagaaccctgaggagctacagtatgattatttgcttcctaagttgccaacggcgtttctggcatcaactgtcattggccttatggcttccttggtcacattgttcggtgctgtcgactggaattcttcagtctttgatggactcagctcttaccagaagattatcaatgcattgttcatggcagtgaacgcaaggcactcgggggagaactccatcgactgctcactcatcgcccctgctgttctagtactgttcatcatcttaatgtacttaccaccatcgacaacatttgcactgtccaatggagatgaaaaaactgcaaataagaaagcgaaaagaaaattaggtttagtggtgcagaacttggcattttcacagcttgcctgcatctcagtctttgtgatagttgcattcatcactgagaggagtcgtctcagaaatgatccactcaacttctctgctctgaacatgatatttgaaatcatcagtgcatatgggaatgtagggctatccactggttacagctgttcgaggttgcagaaactgcacccggggagcatctgccaggacaagccgtacagcttgtccggatggtggagtgatgaaggaaagttgctgctagtctttgtgatgctctatggaaggctcaaggccttcacaaaaggtacaggtgaatattggaggctatggtaa</cdnaseq>

Protein Sequence

<aaseq>MTSIYHDFIHNKLQSFGRIGRYFVNFVVLAHRFIALHIHPFWIQ LSYFLLISILGSVLLMFLKPSNPEFRPGYIDMLFLSTSALTLSSLITIEMEVLSSSQI VVITLLMLLGGEVFVSFLGLMLRLNHKHNPEFSGDKVSSVPIELDTINSASTVISCEE LQLEAAIPEVPSSTIKDLKRSKRLRWFLGFVVFSYFVVIHVAGFLLVLWYISRVSSAK APLKKKGINIALFSFSVTVSSFANVGLVPTNENMAIFSKNPGLLLLFIGQILAGNTLY PLFLRLLIWFLGKVTKLRELKLMIKNPEELQYDYLLPKLPTAFLASTVIGLMASLVTL FGAVDWNSSVFDGLSSYQKIINALFMAVNARHSGENSIDCSLIAPAVLVLFIILMYLP PSTTFALSNGDEKTANKKAKRKLGLVVQNLAFSQLACISVFVIVAFITERSRLRNDPL NFSALNMIFEIISAYGNVGLSTGYSCSRLQKLHPGSICQDKPYSLSGWWSDEGKLLLV FVMLYGRLKAFTKGTGEYWRLW</aaseq>

Gene Sequence

<dnaseqindica>1834..2038#1320..1541#41..1206#gctttctcatactcgttggctcgttgctcctttgcatcaaatgacgagcatttaccatgatttcattcataacaagctgcagagcttcggaaggatcggtagatattttgttaattttgttgttctagcccatagattcattgccttgcatattcacccattctggattcagttgtcctacttccttctcattagcatcctaggttcagttctattgatgttcctgaagccaagcaacccagaattcagaccaggttacattgacatgctgttcttgtcaacctctgctctgacactttccagcctcatcaccatcgaaatggaggttctctcaagctcacaaattgtggttattacactgctgatgcttctcgggggtgaagtctttgtttctttcctaggcctcatgcttagactgaaccataagcacaacccagagttttcaggggacaaggtcagttcagttcctatcgagcttgatacaatcaactcggcaagcactgtgataagttgtgaagagctgcagctggaagcagcaattcctgaagttccatcttccaccattaaggatttgaagaggagcaagcgcctgaggtggttcttaggatttgtagtcttcagctattttgttgtgatccatgtcgctggctttctgctggttctctggtacataagtcgtgtctcatctgcaaaagctccactgaagaagaaagggatcaacattgcactcttctcattctcggtcacagtctcctcgtttgcgaatgtggggctcgtgccgacgaatgagaacatggcaatcttctccaagaacccgggcctcctcctcctgttcatcggccagattcttgcaggcaatacactttaccctctcttcctaaggctattgatatggttcctggggaaggtgaccaagttgagagaactgaagctcatgatcaagaaccctgaggagctacagtatgattatttgcttcctaagttgccaacggcgtttctggcatcaactgtcattggccttatggcttccttggtcacattgttcggtgctgtcgactggaattcttcagtctttgatggactcagctcttaccagaagattatcaatgcattgttcatggcagtgaacgcaaggcactcgggggagaactccatcgactgctcactcatcgcccctgctgttctagtactgttcatcatcttaatgttagttcatgacacctcatctatttatgtttcatgtcatccaactaatactgttagcttcagccttcaggtgatgacatatttgtctgaaactttactttcttggttttcaggtacttaccaccatcgacaacatttgcactgtccaatggagatgaaaaaactgcaaataagaaagcgaaaagaaaattaggtttagtggtgcagaacttggcattttcacagcttgcctgcatctcagtctttgtgatagttgcattcatcactgagaggagtcgtctcagaaatgatccactcaacttctctgctctgaacatgatatttgaaatcatcaggtgtgttcctctctcttgattatgcaatcaaaattctcgtatcaatctgctaagttacactgggcatcaagccaatgatattgtaggcaaaataaaaacaacgaaacacgataaaataataaacttcattagcaaagcaagccaagtagtaagatccacatctgacacctcagaatctttcagaagacaagaaaactaacccaaacatagattgttctcaacaagataactattttgtactattctgtctttctaaaagagtatgcctgttctttcttttttttttttgcagtgcatatgggaatgtagggctatccactggttacagctgttcgaggttgcagaaactgcacccggggagcatctgccaggacaagccgtacagcttgtccggatggtggagtgatgaaggaaagttgctgctagtctttgtgatgctctatggaaggctcaaggccttcacaaaaggtacaggtgaatattggaggctatggtaaaagctgaagcctgaacaaaagcacttgcaaaggcaagtgcatcaagtgcagtatatgtaactatttagagttctgcctgaaagttcaggtttctaattgggccatagtgtataaaaatacacccaatattattcctcttaatacagtggtgcgcaatcctttagcgtattcccgaaaaaaagaacacccaatatgttgcaattgcaatatagaactgttgttctcc</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0701700, RefSeq:Os06g0701700