Difference between revisions of "Os06g0701700"

From RiceWiki
Jump to: navigation, search
(Evolution)
(Labs working on this gene)
Line 15: Line 15:
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
Division of Biological Sciences, Cell and Developmental Biology Section, and Center for Molecular Genetics, University of California,San Diego, La Jolla, CA, USA.
 +
 
 +
National Research Laboratory of Plant Functional Genomics, Department of Life Science, Pohang University of Science and Technology, Kyungbuk, Republic of Korea .
 +
 
 +
Division of Genome and Biodiversity Research, National Institute of Agrobiological Sciences, Ibaraki, Japan.
 +
 
 +
CSIRO Plant Industry, Canberra, Australian Capital Territory 2601, Australia.
 +
 
 +
Key Laboratory of Ministry of Education for Plant Developmental Biology, College of Life Sciences, Wuhan University, Wuhan, Hubei 430072, China .
 +
 
 +
Group of Molecular and Functional Plant Biology, Research Institute for Bioresources, Okayama University, Kurashiki, Okayama 710–0046, Japan.
  
 
==References==
 
==References==

Revision as of 04:36, 22 May 2014

Please input one-sentence summary here.

Annotated Information

Function

The OsHKT2;1 transporter from rice, previously named OsHKT1, functions as a relatively Na+-selective transporter in heterologous expression systems. Compared with related OsHKT2;1 wild-type control plants, OsHKT2;1-null rice showed remarkably reduced growth, accompanied with a withering of the oldest leaf under low Na+ and K+ starvation conditions.[1] Thus, rice OsHKT2;1 transporter can mediate large Na+ influx component into K+-starved roots, allowing improved growth of rice.

Expression

Rice OsHKT2;1 gene, which locates at the plasma membrane, is mainly expressed in cortex cells in roots and in vascular bundle regions in leaves. In addition, the OsHKT2;1 gene expression in intact roots is controlled by external K+ and Na+ concentrations at the transcriptional and posttranslational levels.[1] Both transcriptional and posttranslational mechanisms monitor and down-regulate the amount of Na+ influx via OsHKT2;1 to prevent Na+ over-accumulation and thus Na+ toxicity.[1][2]

Evolution

In rice, there are eight HKT-like genes. OsHKT2;1 is the first gene to be discovered and shares 93% identity at the nucleotide level with OsHKT2;2.[3] Moreover, OsHKT2;1 has 73-76% identity at the positions 669-855,1016-1170 and 1366-1502 with OsHKT2;3/4 in rice.[2]

You can also add sub-section(s) at will.

Labs working on this gene

Division of Biological Sciences, Cell and Developmental Biology Section, and Center for Molecular Genetics, University of California,San Diego, La Jolla, CA, USA.

National Research Laboratory of Plant Functional Genomics, Department of Life Science, Pohang University of Science and Technology, Kyungbuk, Republic of Korea .

Division of Genome and Biodiversity Research, National Institute of Agrobiological Sciences, Ibaraki, Japan.

CSIRO Plant Industry, Canberra, Australian Capital Territory 2601, Australia.

Key Laboratory of Ministry of Education for Plant Developmental Biology, College of Life Sciences, Wuhan University, Wuhan, Hubei 430072, China .

Group of Molecular and Functional Plant Biology, Research Institute for Bioresources, Okayama University, Kurashiki, Okayama 710–0046, Japan.

References

[1] T Horie, A Costa1, TH Kim, MJ Han, R Horie, HY Leung, A Miyao, H Hirochika, G An and JI Schroeder. Rice OsHKT2;1 transporter mediates large Na+ influx component into K+-starved roots for growth. The EMBO Journal .2007, 26: 3003–3014.

[2] SB Huang, W Spielmeyer, ES Lagudah and R Munns. Comparative mapping of HKT genes in wheat, barley, and rice, key determinants of Na+ transport and salt tolerance. Journal of Experimental Botany. 2008, 59(4): 927-937.

[3] X Yao, T Horie, S Xue, HY Leung, M Katsuhara, DE Brodsky,Y Wu and JI Schroeder. Differential Sodium and Potassium Transport Selectivities of the Rice OsHKT2;1 and OsHKT2;2 Transporters in Plant Cells. Plant Physiology. 2010, 152: 341–355.

Structured Information

Gene Name

Os06g0701700

Description

HKT-type transporter (Sodium ion transporter)

Version

NM_001065021.1 GI:115469773 GeneID:4341971

Length

2264 bp

Definition

Oryza sativa Japonica Group Os06g0701700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:30415942..30418205

Sequence Coding Region

30416168..30416372,30416665..30416886,30417000..30418165

Expression

GEO Profiles:Os06g0701700

Genome Context

<gbrowseImage1> name=NC_008399:30415942..30418205 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:30415942..30418205 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgacgagcatttaccatgatttcattcataacaagctgcagagcttcggaaggatcggtagatattttgttaattttgttgttctagcccatagattcattgccttgcatattcacccattctggattcagttgtcctacttccttctcattagcatcctaggttcagttctattgatgttcctgaagccaagcaacccagaattcagaccaggttacattgacatgctgttcttgtcaacctctgctctgacactttccagcctcatcaccatcgaaatggaggttctctcaagctcacaaattgtggttattacactgctgatgcttctcgggggtgaagtctttgtttctttcctaggcctcatgcttagactgaaccataagcacaacccagagttttcaggggacaaggtcagttcagttcctatcgagcttgatacaatcaactcggcaagcactgtgataagttgtgaagagctgcagctggaagcagcaattcctgaagttccatcttccaccattaaggatttgaagaggagcaagcgcctgaggtggttcttaggatttgtagtcttcagctattttgttgtgatccatgtcgctggctttctgctggttctctggtacataagtcgtgtctcatctgcaaaagctccactgaagaagaaagggatcaacattgcactcttctcattctcggtcacagtctcctcgtttgcgaatgtggggctcgtgccgacgaatgagaacatggcaatcttctccaagaacccgggcctcctcctcctgttcatcggccagattcttgcaggcaatacactttaccctctcttcctaaggctattgatatggttcctggggaaggtgaccaagttgagagaactgaagctcatgatcaagaaccctgaggagctacagtatgattatttgcttcctaagttgccaacggcgtttctggcatcaactgtcattggccttatggcttccttggtcacattgttcggtgctgtcgactggaattcttcagtctttgatggactcagctcttaccagaagattatcaatgcattgttcatggcagtgaacgcaaggcactcgggggagaactccatcgactgctcactcatcgcccctgctgttctagtactgttcatcatcttaatgtacttaccaccatcgacaacatttgcactgtccaatggagatgaaaaaactgcaaataagaaagcgaaaagaaaattaggtttagtggtgcagaacttggcattttcacagcttgcctgcatctcagtctttgtgatagttgcattcatcactgagaggagtcgtctcagaaatgatccactcaacttctctgctctgaacatgatatttgaaatcatcagtgcatatgggaatgtagggctatccactggttacagctgttcgaggttgcagaaactgcacccggggagcatctgccaggacaagccgtacagcttgtccggatggtggagtgatgaaggaaagttgctgctagtctttgtgatgctctatggaaggctcaaggccttcacaaaaggtacaggtgaatattggaggctatggtaa</cdnaseq>

Protein Sequence

<aaseq>MTSIYHDFIHNKLQSFGRIGRYFVNFVVLAHRFIALHIHPFWIQ LSYFLLISILGSVLLMFLKPSNPEFRPGYIDMLFLSTSALTLSSLITIEMEVLSSSQI VVITLLMLLGGEVFVSFLGLMLRLNHKHNPEFSGDKVSSVPIELDTINSASTVISCEE LQLEAAIPEVPSSTIKDLKRSKRLRWFLGFVVFSYFVVIHVAGFLLVLWYISRVSSAK APLKKKGINIALFSFSVTVSSFANVGLVPTNENMAIFSKNPGLLLLFIGQILAGNTLY PLFLRLLIWFLGKVTKLRELKLMIKNPEELQYDYLLPKLPTAFLASTVIGLMASLVTL FGAVDWNSSVFDGLSSYQKIINALFMAVNARHSGENSIDCSLIAPAVLVLFIILMYLP PSTTFALSNGDEKTANKKAKRKLGLVVQNLAFSQLACISVFVIVAFITERSRLRNDPL NFSALNMIFEIISAYGNVGLSTGYSCSRLQKLHPGSICQDKPYSLSGWWSDEGKLLLV FVMLYGRLKAFTKGTGEYWRLW</aaseq>

Gene Sequence

<dnaseqindica>1834..2038#1320..1541#41..1206#gctttctcatactcgttggctcgttgctcctttgcatcaaatgacgagcatttaccatgatttcattcataacaagctgcagagcttcggaaggatcggtagatattttgttaattttgttgttctagcccatagattcattgccttgcatattcacccattctggattcagttgtcctacttccttctcattagcatcctaggttcagttctattgatgttcctgaagccaagcaacccagaattcagaccaggttacattgacatgctgttcttgtcaacctctgctctgacactttccagcctcatcaccatcgaaatggaggttctctcaagctcacaaattgtggttattacactgctgatgcttctcgggggtgaagtctttgtttctttcctaggcctcatgcttagactgaaccataagcacaacccagagttttcaggggacaaggtcagttcagttcctatcgagcttgatacaatcaactcggcaagcactgtgataagttgtgaagagctgcagctggaagcagcaattcctgaagttccatcttccaccattaaggatttgaagaggagcaagcgcctgaggtggttcttaggatttgtagtcttcagctattttgttgtgatccatgtcgctggctttctgctggttctctggtacataagtcgtgtctcatctgcaaaagctccactgaagaagaaagggatcaacattgcactcttctcattctcggtcacagtctcctcgtttgcgaatgtggggctcgtgccgacgaatgagaacatggcaatcttctccaagaacccgggcctcctcctcctgttcatcggccagattcttgcaggcaatacactttaccctctcttcctaaggctattgatatggttcctggggaaggtgaccaagttgagagaactgaagctcatgatcaagaaccctgaggagctacagtatgattatttgcttcctaagttgccaacggcgtttctggcatcaactgtcattggccttatggcttccttggtcacattgttcggtgctgtcgactggaattcttcagtctttgatggactcagctcttaccagaagattatcaatgcattgttcatggcagtgaacgcaaggcactcgggggagaactccatcgactgctcactcatcgcccctgctgttctagtactgttcatcatcttaatgttagttcatgacacctcatctatttatgtttcatgtcatccaactaatactgttagcttcagccttcaggtgatgacatatttgtctgaaactttactttcttggttttcaggtacttaccaccatcgacaacatttgcactgtccaatggagatgaaaaaactgcaaataagaaagcgaaaagaaaattaggtttagtggtgcagaacttggcattttcacagcttgcctgcatctcagtctttgtgatagttgcattcatcactgagaggagtcgtctcagaaatgatccactcaacttctctgctctgaacatgatatttgaaatcatcaggtgtgttcctctctcttgattatgcaatcaaaattctcgtatcaatctgctaagttacactgggcatcaagccaatgatattgtaggcaaaataaaaacaacgaaacacgataaaataataaacttcattagcaaagcaagccaagtagtaagatccacatctgacacctcagaatctttcagaagacaagaaaactaacccaaacatagattgttctcaacaagataactattttgtactattctgtctttctaaaagagtatgcctgttctttcttttttttttttgcagtgcatatgggaatgtagggctatccactggttacagctgttcgaggttgcagaaactgcacccggggagcatctgccaggacaagccgtacagcttgtccggatggtggagtgatgaaggaaagttgctgctagtctttgtgatgctctatggaaggctcaaggccttcacaaaaggtacaggtgaatattggaggctatggtaaaagctgaagcctgaacaaaagcacttgcaaaggcaagtgcatcaagtgcagtatatgtaactatttagagttctgcctgaaagttcaggtttctaattgggccatagtgtataaaaatacacccaatattattcctcttaatacagtggtgcgcaatcctttagcgtattcccgaaaaaaagaacacccaatatgttgcaattgcaatatagaactgttgttctcc</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0701700, RefSeq:Os06g0701700