Difference between revisions of "Os06g0286700"

From RiceWiki
Jump to: navigation, search
(References)
(References)
Line 25: Line 25:
  
 
==References==
 
==References==
 +
<references>
 +
<ref name="ref1"> Jinling L, Yajun H, Yuese N, Nan J, Jun W, et al. (2011) Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species. Journal of Plant Biology, 54(5): 294-302.</ref>
 +
<ref name="ref2">Nan J, Zhiqiang L, Jun W, Yue W, Lijun W, et al. (2012)Molecular mapping of the Pi2/9 allelic gene Pi2-2 conferring broad-spectrum resistance to Magnaporthe oryzae in the rice cultivar Jefferson. Rice 5: 29.</ref>
 +
</references>
 +
 
Please input cited references here.
 
Please input cited references here.
 
1.H. L. Chen, B. T. Chen, D. P. Zhang, Y. F. Xie, and Qifa Zhang, 2001, Pathotypes of Pyricularia grisea in Rice Fields of Central and Southern China, Plant Disease 85:843-850.
 
1.H. L. Chen, B. T. Chen, D. P. Zhang, Y. F. Xie, and Qifa Zhang, 2001, Pathotypes of Pyricularia grisea in Rice Fields of Central and Southern China, Plant Disease 85:843-850.
Line 30: Line 35:
 
3. H. Jiang ,Y. Feng , L. Bao ,X. Li, G. Gao, Q. Zhang , J. Xiao , C. Xu _ Y. He,2012, Improving blast resistance of Jin 23B and its hybrid rice by marker-assisted gene pyramiding, Mol Breeding (2012) 30:1679–1688
 
3. H. Jiang ,Y. Feng , L. Bao ,X. Li, G. Gao, Q. Zhang , J. Xiao , C. Xu _ Y. He,2012, Improving blast resistance of Jin 23B and its hybrid rice by marker-assisted gene pyramiding, Mol Breeding (2012) 30:1679–1688
 
4. Zhao P,Feng R.R,Xiao Q Zh,Yang P.Zh,Lin. W,Liu P.Q,Li.RB,2013,Pyramiding brown planthopper genes, bph20(t)and bph21(t),and rice blast resistant gene Pi9 in rice (Oryza sativa L.), Journal of Southen Agricalture,44(6):885-892
 
4. Zhao P,Feng R.R,Xiao Q Zh,Yang P.Zh,Lin. W,Liu P.Q,Li.RB,2013,Pyramiding brown planthopper genes, bph20(t)and bph21(t),and rice blast resistant gene Pi9 in rice (Oryza sativa L.), Journal of Southen Agricalture,44(6):885-892
 
 
 
<references>
 
<ref name="ref1"> Jinling L, Yajun H, Yuese N, Nan J, Jun W, et al. (2011) Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species. Journal of Plant Biology, 54(5): 294-302.</ref>
 
<ref name="ref2">Nan J, Zhiqiang L, Jun W, Yue W, Lijun W, et al. (2012)Molecular mapping of the Pi2/9 allelic gene Pi2-2 conferring broad-spectrum resistance to Magnaporthe oryzae in the rice cultivar Jefferson. Rice 5: 29.</ref>
 
</references>
 
 
<references>
 
<ref name="ref1">Sasaki A, Ashikari M, Ueguchi-Tanaka M, Itoh H, Nishimura A, et al. (2002) Green revolution: a mutant gibberellin-synthesis gene in rice. Nature 416: 701-702.</ref>
 
<ref name="ref2">Spielmeyer W, Ellis MH, Chandler PM (2002) Semidwarf (sd-1), "green revolution" rice, contains a defective gibberellin 20-oxidase gene. Proc Natl Acad Sci U S A 99: 9043-9048.</ref>
 
<ref name="ref3">Monna L, Kitazawa N, Yoshino R, Suzuki J, Masuda H, et al. (2002) Positional cloning of rice semidwarfing gene, sd-1: rice "green revolution gene" encodes a mutant enzyme involved in gibberellin synthesis. DNA Res 9: 11-17.</ref>
 
<ref name="ref4">Hedden P. (2003) The genes of the Green Revolution. Trends Genet 19: 5-9.</ref>
 
<ref name="ref5">Peng J, Richards DE, Hartley NM, Murphy GP, Devos KM, et al. (1999) 'Green revolution' genes encode mutant gibberellin response modulators. Nature 400: 256-261.</ref>
 
<ref name="ref6">Asano K, Hirano K, Ueguchi-Tanaka M, Angeles-Shim RB, Komura T, et al. (2009) Isolation and characterization of dominant dwarf mutants, ''Slr1-d'', in rice. Mol Genet Genomics 281: 223-231.</ref>
 
<ref name="ref7">Reagon M, Thurber CS, Olsen KM, Jia Y, Caicedo AL (2011) The long and the short of it: SD1 polymorphism and the evolution of growth trait divergence in U.S. weedy rice. Mol Ecol 20: 3743-3756.</ref>
 
</references>
 
  
 
==Structured Information==
 
==Structured Information==

Revision as of 16:12, 22 May 2014

This is a broad-spectrum resistance(R) gene to rice blast

Annotated Information

尼松伟

Function

Blast is a very common disease found in rice. Blast causes immense damage to rice in rice-growing countries .And Pi9 alleles are mainly responsible for resistance to rice blast. We can use Pi1 and pi2 to improve the resistance ability to blast through hybridization.

Expression

editing We test the relationship between Pi1,Pi2 and D12 gene in expression. When Pi1,Pi2 and D12 gene unit together, they will improve the resistance to blast by a great deal in the field condition.Pi9 gene lies on the chromosome6.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here. 1.National Key Laboratory of Crop Genetic Improvement, 2.National Center of Plant Gene Research and National 3.Center of Crop Molecular Breeding, Huazhong 4.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 5.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 6. 2Guangxi Key Laboratory of Subtropical Bioresource Conversation and Utilization,Nanning

References

Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.

Please input cited references here. 1.H. L. Chen, B. T. Chen, D. P. Zhang, Y. F. Xie, and Qifa Zhang, 2001, Pathotypes of Pyricularia grisea in Rice Fields of Central and Southern China, Plant Disease 85:843-850. 2 J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302 3. H. Jiang ,Y. Feng , L. Bao ,X. Li, G. Gao, Q. Zhang , J. Xiao , C. Xu _ Y. He,2012, Improving blast resistance of Jin 23B and its hybrid rice by marker-assisted gene pyramiding, Mol Breeding (2012) 30:1679–1688 4. Zhao P,Feng R.R,Xiao Q Zh,Yang P.Zh,Lin. W,Liu P.Q,Li.RB,2013,Pyramiding brown planthopper genes, bph20(t)and bph21(t),and rice blast resistant gene Pi9 in rice (Oryza sativa L.), Journal of Southen Agricalture,44(6):885-892

Structured Information

Gene Name

Os06g0286700

Description

Similar to NBS-LRR disease resistance protein homologue

Version

NM_001063943.1 GI:115467617 GeneID:4340778

Length

2957 bp

Definition

Oryza sativa Japonica Group Os06g0286700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:10386510..10389466

Sequence Coding Region

10386510..10386566,10386662..10389466

Expression

GEO Profiles:Os06g0286700

Genome Context

<gbrowseImage1> name=NC_008399:10386510..10389466 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:10386510..10389466 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</cdnaseq>

Protein Sequence

<aaseq>MQAFLRAAEVMKKKDELLKLVKLRERHRIAIRIHNLKSRVEEVS SRNTRYNLVEPISSGTEDDMDSYAEDIRNQSARNVDEAELVGFSDSKKRLLEMIDTNA NDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMI RQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINE IAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDM ESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSELEINPSLEA LRRMVTLGYNHLPSHLKPCFLYLSIFPEDFEIKRNRLVGRWIAEGFVRPKVGMTTKDV GESYFNELINRSMIQRSRVGIAGKIKTCRIHDIIRDITVSISRQENFVLLPMGDGSDL VQENTRHIAFHGSMSCKTGLDWSIIRSLAIFGDRPKSLAHAVCPDQLRMLRVLDLEDV TFLITQKDFDHIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSE ISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHM ATKSCWSESFGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNG STKEKCKILYAAIEKLSSLQSLHVDAVLFSGIIGTLECLDSISSPPPLLRTLRLNGSL EEMPNWIEQLTHLKKFDLRRSKLKEGKTMLILGALPNLMVLYLYRNAYLGEKLVFKTG AFPNLRTLCIYELDQLREIRFEDGSSPLLEKIEIGKCRLESGIIGIIHLPKLKEIPIT YGSKVAGLGQLEGEVNTHPNRPVLLMYSDRRYHDLGAEAEGSSIEVQTADPVPDAEGS VTVAVEATDPLPEQEGESSQSQVITLTTNDRSVTPYMAA</aaseq>

Gene Sequence

<dnaseqindica>1..57#153..2957#atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaaggtttgggcagagcaaatacgtgacctgtcgtatgacattgaagattccctgatgaatttaaagtccatattgaaagccaaaccctatttcgtcagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0286700, RefSeq:Os06g0286700