Difference between revisions of "Os09g0439200"
(→Function) |
(→Expression) |
||
| Line 10: | Line 10: | ||
===Expression=== | ===Expression=== | ||
OsTIFY family genes had distinct expression patterns.OsTIFY10c showed high expression in the callus and leaves. | OsTIFY family genes had distinct expression patterns.OsTIFY10c showed high expression in the callus and leaves. | ||
| − | qRT–PCR analysis of JAZ genes in rice after treatment with 100mM JA for 24 h, EightJAZ genes (OsJAZ 1, 3, 4, 7, 8, 9, 10and 12) were significantly up-regulated by JA, with OsJAZ8 exhibiting the highest up-regulation among the JA-responsive JAZ genes in rice (Fig. 2A). After JA treatment, OsJAZ8 expression reached a maximum level at 24 h in the tested period (Fig. 2B). However, after inoculation with virulent Xoo, OsJAZ8 expression was not up-regulated in the tested period (Fig. 2C). | + | qRT–PCR analysis of JAZ genes in rice after treatment with 100mM JA for 24 h, EightJAZ genes (OsJAZ 1, 3, 4, 7, 8, 9, 10and 12) were significantly up-regulated by JA, with OsJAZ8 exhibiting the highest up-regulation among the JA-responsive JAZ genes in rice (Fig. 2A). After JA treatment, OsJAZ8 expression reached a maximum level at 24 h in the tested period (Fig. 2B). However, after inoculation with virulent Xoo, OsJAZ8 expression was not up-regulated in the tested period (Fig. 2C).When the Jas domain-truncated OsJAZ8 (OsJAZ8�C) was |
| + | overexpressed in rice, the transgenic rice plants exhibited | ||
| + | JA-insensitive phenotypes, such as resistance to JA-induced inhibition of root growth and inhibition of JA-induced Chl reduction. These results indicate that expression of OsJAZ8�C | ||
| + | inhibits JA responsiveness via the dominant-negative activity | ||
| + | of the altered OsJAZ8 protein. | ||
===Evolution=== | ===Evolution=== | ||
Revision as of 08:35, 23 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
OsJAZ8 is a rice jasmonate ZIM-domain protein and acts as a repressor of JA signaling in rice.OsJAZ8 negatively regulates the JA-induced resistance toXooin rice. OsJAZ8exhibited the highest up-regulation among the JA-responsiveJAZ genes in rice. OsJAZ8 interacted with OsCOI1H, which is a component of the SCF complex, and was degraded via the 26S proteasome pathway in a COR-dependent manner. OsJAZ8 may function as a heterodimer with other JAZ proteins to repress JA signaling in rice.
Expression
OsTIFY family genes had distinct expression patterns.OsTIFY10c showed high expression in the callus and leaves. qRT–PCR analysis of JAZ genes in rice after treatment with 100mM JA for 24 h, EightJAZ genes (OsJAZ 1, 3, 4, 7, 8, 9, 10and 12) were significantly up-regulated by JA, with OsJAZ8 exhibiting the highest up-regulation among the JA-responsive JAZ genes in rice (Fig. 2A). After JA treatment, OsJAZ8 expression reached a maximum level at 24 h in the tested period (Fig. 2B). However, after inoculation with virulent Xoo, OsJAZ8 expression was not up-regulated in the tested period (Fig. 2C).When the Jas domain-truncated OsJAZ8 (OsJAZ8�C) was overexpressed in rice, the transgenic rice plants exhibited JA-insensitive phenotypes, such as resistance to JA-induced inhibition of root growth and inhibition of JA-induced Chl reduction. These results indicate that expression of OsJAZ8�C inhibits JA responsiveness via the dominant-negative activity of the altered OsJAZ8 protein.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os09g0439200 |
|---|---|
| Description |
ZIM domain containing protein |
| Version |
NM_001069808.1 GI:115479358 GeneID:4347164 |
| Length |
1747 bp |
| Definition |
Oryza sativa Japonica Group Os09g0439200, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 9:16927233..16928979 |
| Sequence Coding Region |
16927643..16927760,16927878..16927935,16928082..16928272,16928493..16928643,16928730..16928910 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008402:16927233..16928979 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008402:16927233..16928979 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggccggccgtgcgacggcgacggcgacggcggcggggaaggacaggtccagcttcgccgtcacctgtagcctcctcagccagtttctcaaggagaagaagggcggcggcggcgggctgcaggggctcggcctcggcttgcggccggcgccggcggcgccgcccgccgcgggagctggaggtgctttccggccgccgccgaccaccatgaacttgctgtcggggctcgacgcgccggcggtggaggtggagccaaacacggcggaaacagcggccgacgagctgcctctcatcaaggccccggccgatcagcaaagcgacgaaagtgcaagtgaggcagctggagagaaggctcaacagctgaccatcttctacggtggaaaagtagtcgtctttgagaacttcccgtccaccaaggtcaaggatctcttacaaatcgtaagcacaggcgatggcgtcgacaagaacaccggcaccgcggcaacgcagagcctgccccgacccgcacacaacagtcttcccgatctgccgattgcaaggaggaactcgctccataggtttctcgagaagagaaagggcaggatgaatgcaaatgctccataccaagctaactgcaccgctgcaccgtccaagcaagctaacggtgacaaatcttggcttgggtttggccaagagatgacaataaagcaggagatatga</cdnaseq> |
| Protein Sequence |
<aaseq>MAGRATATATAAGKDRSSFAVTCSLLSQFLKEKKGGGGGLQGLG LGLRPAPAAPPAAGAGGAFRPPPTTMNLLSGLDAPAVEVEPNTAETAADELPLIKAPA DQQSDESASEAAGEKAQQLTIFYGGKVVVFENFPSTKVKDLLQIVSTGDGVDKNTGTA ATQSLPRPAHNSLPDLPIARRNSLHRFLEKRKGRMNANAPYQANCTAAPSKQANGDKS WLGFGQEMTIKQEI</aaseq> |
| Gene Sequence |
<dnaseqindica>1220..1337#1045..1102#708..898#337..487#70..250#agagagagacaaccagacgggagcttgtcggggaggagagagagagagagtggtggtggtggtggtgagatggccggccgtgcgacggcgacggcgacggcggcggggaaggacaggtccagcttcgccgtcacctgtagcctcctcagccagtttctcaaggagaagaagggcggcggcggcgggctgcaggggctcggcctcggcttgcggccggcgccggcggcgccgcccgccgcgggagctggaggtaataagcgattgtgttcgtcatgcgattaaattagcagcgacttgttttgtttcttaccacgtatggggtgttggtctttgcaggtgctttccggccgccgccgaccaccatgaacttgctgtcggggctcgacgcgccggcggtggaggtggagccaaacacggcggaaacagcggccgacgagctgcctctcatcaaggccccggccgatcagcaaagcgacgaaagtgcaaggtacaaacaatctctagtacactctgcatcctgacatctcacgatctcaaacaaactctctcctgttcattaaaaaagagtagtaaaatgaacataaaacatgttatcctgacttgcaacttgcatccttatacaatgtctagaagaagaagaaaacacacttaattttttggagtagagataatttggttgcaactgtctctttggttctttcttccagtgaggcagctggagagaaggctcaacagctgaccatcttctacggtggaaaagtagtcgtctttgagaacttcccgtccaccaaggtcaaggatctcttacaaatcgtaagcacaggcgatggcgtcgacaagaacaccggcaccgcggcaacgcagagcctgccccgacccgcacacaacagtcttcccggtaataacaactgttcattcttttgcagttttacattttaccatcacagtgctaattaatttccatctactatgcttaaatttatctactacatgtgaaacaatgtaggaatccttaacgaatgactgatttttgatttgttacagatctgccgattgcaaggaggaactcgctccataggtttctcgagaagagaaagggcaggtaggtaactgagtggctttcaacttctatctgaaatacttgcctttcgctgtcaaaaactggctgtcagaccaagtttatggccctaaaattctccatgctcttcaaccactccaggatgaatgcaaatgctccataccaagctaactgcaccgctgcaccgtccaagcaagctaacggtgacaaatcttggcttgggtttggccaagagatgacaataaagcaggagatatgatatgacctcttagcttacagttcactgtcaagtgtcaagtgatctgtggggaagagatgcgtggttggctggttgctagtgctagtgtattcccccgtagcttcaaagcatgaataattactcaatactactacattactactagtaagaacttaatcaatactaggaatcaagctggtggttaattctgcctgaccattggcatcctggaatatatataagcacacacacgggttgtttgttctccacattgtttgctgctggagccgtatgctcactgcagtttatatctgtctagctggttacccacctcagcctcaccatgtttcgggaataaacactgtgtatgtgcaaattcttcatttctcgttcggtttcgccgtataaattacattgttactattttggct</dnaseqindica> |
| External Link(s) |