Difference between revisions of "Os03g0753100"

From RiceWiki
Jump to: navigation, search
(Mutation)
(Mutation)
Line 7: Line 7:
 
===Mutation===
 
===Mutation===
 
*Figure 1 shows the Phenotype of the wild type and pap2-1 mutant in panicle development.the arrangement of lateral organs, such as rachis branches and spikelets, was disordered and the panicle became irregularly denser, in sharp contrast to the well-defi ned phyllotaxy of the wild-type panicle ( Fig. 1B–D ).A signifi cant increase in the number of primary rachis branches per panicle was observed in pap2-1 , indicating that the IM activity was maintained longer in pap2-1 than in the wild-type ( Fig. 1F ).In the wild-type panicle, 31.0 % of lateral organs produced in the primary rachis branches grow as secondary rachis branches, whereas 70.8 % become secondary branches in pap2-1 ( Fig. 1G ).
 
*Figure 1 shows the Phenotype of the wild type and pap2-1 mutant in panicle development.the arrangement of lateral organs, such as rachis branches and spikelets, was disordered and the panicle became irregularly denser, in sharp contrast to the well-defi ned phyllotaxy of the wild-type panicle ( Fig. 1B–D ).A signifi cant increase in the number of primary rachis branches per panicle was observed in pap2-1 , indicating that the IM activity was maintained longer in pap2-1 than in the wild-type ( Fig. 1F ).In the wild-type panicle, 31.0 % of lateral organs produced in the primary rachis branches grow as secondary rachis branches, whereas 70.8 % become secondary branches in pap2-1 ( Fig. 1G ).
[[File:File.png|200px|thumb|right|Figure1.Awn lenghth comparion among different plants]]
+
[[File:File.png|200px|thumb|right|Fig1.Phenotype of the wild type and the pap2-1 mutant in panicle development]]
 
*Figure 2 shows the Phenotype of the wild and pap2-1 mutant in spikelet development.(A–C) shows the Spikelets in the wild-type (A) and pap2-1 (B, C).(D–F)shows SEM analysis of the spikelet of wild-type (D) and pap2-1 (E, F).(G and H) shows the number of rudimentary glumes (G) and
 
*Figure 2 shows the Phenotype of the wild and pap2-1 mutant in spikelet development.(A–C) shows the Spikelets in the wild-type (A) and pap2-1 (B, C).(D–F)shows SEM analysis of the spikelet of wild-type (D) and pap2-1 (E, F).(G and H) shows the number of rudimentary glumes (G) and
 
sterile lemmas (H) in the wild-type and pap2-1 .Approximately 60 % of the spikelets in a pap2-1 panicle exhibited elongated rudimentary glumes, and 40 % of them developed an ectopic filamentous organ.Approximately 13 % of the sterile lemmas elongated to about half the size of the lemma, 65 % grew to a similar size and 23 % grew longer.
 
sterile lemmas (H) in the wild-type and pap2-1 .Approximately 60 % of the spikelets in a pap2-1 panicle exhibited elongated rudimentary glumes, and 40 % of them developed an ectopic filamentous organ.Approximately 13 % of the sterile lemmas elongated to about half the size of the lemma, 65 % grew to a similar size and 23 % grew longer.

Revision as of 08:39, 23 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Rice PAP2 encodes MADS34, a grass-specific SEPALLATA(SEP) subfamily MADS domain protein.PAP2 functions as a positive regulator of SM identity[1].PAP2 also functions as a suppressor of the extra elongation of glumes[2].In addtion,PAP2 activated in the meristem at phase transition and function in specifying IM identity in rice[3].

Mutation

  • Figure 1 shows the Phenotype of the wild type and pap2-1 mutant in panicle development.the arrangement of lateral organs, such as rachis branches and spikelets, was disordered and the panicle became irregularly denser, in sharp contrast to the well-defi ned phyllotaxy of the wild-type panicle ( Fig. 1B–D ).A signifi cant increase in the number of primary rachis branches per panicle was observed in pap2-1 , indicating that the IM activity was maintained longer in pap2-1 than in the wild-type ( Fig. 1F ).In the wild-type panicle, 31.0 % of lateral organs produced in the primary rachis branches grow as secondary rachis branches, whereas 70.8 % become secondary branches in pap2-1 ( Fig. 1G ).
Fig1.Phenotype of the wild type and the pap2-1 mutant in panicle development
  • Figure 2 shows the Phenotype of the wild and pap2-1 mutant in spikelet development.(A–C) shows the Spikelets in the wild-type (A) and pap2-1 (B, C).(D–F)shows SEM analysis of the spikelet of wild-type (D) and pap2-1 (E, F).(G and H) shows the number of rudimentary glumes (G) and

sterile lemmas (H) in the wild-type and pap2-1 .Approximately 60 % of the spikelets in a pap2-1 panicle exhibited elongated rudimentary glumes, and 40 % of them developed an ectopic filamentous organ.Approximately 13 % of the sterile lemmas elongated to about half the size of the lemma, 65 % grew to a similar size and 23 % grew longer.

Expression

PAP2 expression starts the earliest among the five SEP genes, and a low but signifi cant level of PAP2 mRNA was detected in the infl orescence meristem, in branch meristems immediately after the transition, and in glume primordia, consistent with its role in the early development of spikelet formation.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os03g0753100

Description

Transcription factor, MADS-box domain containing protein

Version

NM_001057836.1 GI:115455400 GeneID:4334141

Length

6667 bp

Definition

Oryza sativa Japonica Group Os03g0753100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:31811507..31818173

Sequence Coding Region

31811787..31811859,31812105..31812238,31812639..31812680,31812809..31812850,31813558..31813657
,31813801..31813862,31815294..31815375,31817706..31817890

Expression

GEO Profiles:Os03g0753100

Genome Context

<gbrowseImage1> name=NC_008396:31811507..31818173 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:31811507..31818173 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggggcgaggcaaggtggtgcttcagcggatcgagaacaagatcagccggcaggtgacgttcgccaagcggcggaacggcctgctcaagaaggcctacgagctctccatcctctgcgacgccgaggtcgccctcgtcctcttctcccacgccggccgcctctaccagttctcctcctcatccaacatgcttaagacgcttgagagataccagaggtacatttatgcttcgcaagatgctgccgcaccaactagcgatgagatgcagaacaactatcaggaatatgtgaacttgaaggcacatgttgagattctgcaacaatcacaaaggaaccttctaggtgaggatttagctccactggctacaaatgaacttgagcagcttgagagtcaagtagtcagaaccttgaagcaaatcagatcaagaaagactcaggtactacttgatgaactctgcgacctaaagagaaaggaacaaatgctacaagatgcaaacagggtcctgaaaaggaagcttgacgagatcgacgtagaggcagctcccccacagcctccatggaacggaaactgcagcaatggccatggcggcggcggcggcgtgttttccagtgagcctccccaaccagagcacttcttccaggccctcgggcttcatgccgtggacgtgaaccagccgccggcgccgccaccgggcggttatcctcctgagtggatggcctag</cdnaseq>

Protein Sequence

<aaseq>MGRGKVVLQRIENKISRQVTFAKRRNGLLKKAYELSILCDAEVA LVLFSHAGRLYQFSSSSNMLKTLERYQRYIYASQDAAAPTSDEMQNNYQEYVNLKAHV EILQQSQRNLLGEDLAPLATNELEQLESQVVRTLKQIRSRKTQVLLDELCDLKRKEQM LQDANRVLKRKLDEIDVEAAPPQPPWNGNCSNGHGGGGGVFSSEPPQPEHFFQALGLH AVDVNQPPAPPPGGYPPEWMA</aaseq>

Gene Sequence

<dnaseqindica>6315..6387#5936..6069#5494..5535#5324..5365#4517..4616#4312..4373#2799..2880#284..468#aattaagccacagcttgagcagatcagctgcaggccggccggtgtgcgtgtgtgacagtaggagagagagctagcgagagagagcaaggaatcggaattgatttcatgcactgatcgatccatccatcatgcagatgctgcatggatgagaagagctagcagctaagctttgctgaagaaaattcttcagaggtttgtgttgatttgctggtctgctagagatcgatctagagagagagagaggaagggaagactgaagagagatctcgagcgggagatcgagatggggcgaggcaaggtggtgcttcagcggatcgagaacaagatcagccggcaggtgacgttcgccaagcggcggaacggcctgctcaagaaggcctacgagctctccatcctctgcgacgccgaggtcgccctcgtcctcttctcccacgccggccgcctctaccagttctcctcctcatccaagtaaacccactgcccctctcactcatctcagcttcctcctcttcccctaatcaaattctctcaacttgcttaacctgcactccccaaaccgcaatttgctccatctttgcgcgcacaatctgcaagaaatcacgaccgatctgaattttctcgcgcgtgtactgtatccgtcgtcgtccgtgcatgaacttatgggaggggccatgatttcgtacgtgttgttttttctacgcctgttcctttctttctgttctattgggcgaagctactgttcatgtaaaaaaggctacaaaagaacaaggcaaagaagacgaggttgtcctcggcaggagatccagacatgtacatatatgcgtatatataccgtgtgtgtatatatgtatgtgtgtcatagcaggcaagaaaaattaagaaaggggtttcatttgatgtaaatatcatggcgtgtacaaatgctagaatctgaattagcctaaaatttggaggatttaacttgatggagtttaaataatttacttggaagaatgccacttttagtactagctgttgatgagcaaaatttgctgaagaatgccgcttttgatcaaaatttgtcgtttacttatatattatcaaggatacttttgtgtgttaattataaacttgctgcaataaatatctcatgaacacaacacactagttaaactcaccaacatcgtcatgtgttaattcatctacggcttggaacttgcaagaactactttaacgtacaagctctgactttgtatatctgacagtaccaaaatactgttaccttatagctacgttggaaaagatcaactgtacaactactttcagctctataaaacaattcactgtaggcaaatgcaccgtccatatatatagacactctgtgaggtagaattgctaatttatagtatattattatattaacgtgtaattgacccatacaggataatcttcaaatttggggcagtttgcatgaaatgtggaactcacattagcaaaaattgcatattaaagaatacactgaccatgttaatatacatgctagtgagttatagtttgtatggggatgctaatatgttttggcctttttccccatatgaatgtatgctacattcttacaattaatatatacgttacaaagggaaatcaaatgacctagtagtttctattactgaattattgcacatttagtttttccaatcaatcactaaattgccataagggtccagtttttttgtctgtttcttgttggttctttgtcaagtatcatatatatatgtaccatatttttgtaggaatatgcattcgcgctagctaccgtatgatgatcacacaggtttcaacccttggttaacactgttaatttgttgttataaggggtatcatccatagagacagattactgtatttgaataagagatttctgtataataatgctatgccgttattggttctttatcaagtgccacagtaccttgtttttgtagtatatgtgttcactagctaccatgtgatgatcacacaaagtttcaccgttggtgaactgttaatttgtcatatgtgacatgcatcatccatagatacacgtttctcatattaataatttttaaatattgctaggaaaaaatggtgtcttattgggttataacacactagaatattgttttatttttatccttcatcctcagtgaaaaaggatgtacaattagtggcttggcacagactagggctgctttgttaattagatcaccttttatttttctcctaaaggtgaggggggggggggacgaaaacacttcggatggagcggcatacaaatttaaagctatattttccatatatttatttgcatttttcttgtttaatttggtataatcaattttctggtggcaccaaagcacctaagatggacttaggttgggttctttacttcttttagacactttctcaacttctattatctcgtttactttgtacgtttcccaaattgctaaacaatacgttttttataaaaatctataagaaagttgcttataaaaaaccatattaatctatttttaagtttttttaagctaatacttaattaatcgtgcgttactttgttttgtgtgcgagagggaacagttcccaaccctctccaatgaatgtaccctaaaggaggcttgattttttttttcctgaggaagaaaatgacaacgaaacattcacaaattgatcggaagacataattaacagctttattaatatactatttcttttaggggaaacatattttctgtatagtgtgctagttaaccatctatctctaattcatatttcagcatgcttaagacgcttgagagataccagaggtacatttatgcttcgcaagatgctgccgcaccaactagcgatgagatgcaggtttgataattttattcagtttatggcacattatttgttgatgtttttattgacataatcatttttgcataatgtcccctagaaaattaaccatcaggtaattgcttccagtatttttatttgtgttataatctactagagattgatttatgagaggcaatctttacactagaaaactgttttctcatgaaatttaacttttaaaagtactcatgagatgtgatcataaaaaccgtactcctctctcactatgagaagaaagaatagtaaattcttgagtcatagacatccatagcttgaaatataatgactcttcttaaggcaaagattcctttcctctcatagctagcctcaccggccatttaacttttgacaaggaaaaagaaagatcaattgtgcccatttgtaatttgcaccgggcattaagaccagagatacctaagtcaccggaaattgggaacacatgtataaatcgatggccattggcctagtgcatttcatgcattaccttctataaggatttctttgttcaacaattctcatgcaagcacatactaatgcgttgtgcacttcctttgaattccagtttagttaagtttgtggagcttcggatttgcttgcaagcccaaagaagcagataagaacagtatttatctagctaaatgggcaacgcatacatgatgtaaatgtgataaatgtttattgaacatatccatggggatctgggtgcactagatagagtatatatagtatctcttcgtagttactccgtcaattattggcattcatcataaactctacgcatctctctacagggaccattttagttttaattaccatgttcacatctttaatttgtttattatacgtactgcaaatataacttggcctatacttaatataactaggcgattgtctcatgcaaattgcatggtgctagatttcaaaagtagaattagatttgatatgcaatactttaactctattcgattgatacaattgtattttctacctaatatattttttttaaaaaaaatagaattggatttcatatacaatttctaccttttttttctatagctacaattgcattttatatgcagatatattcatcaatctaaactataatgagctagaccccacgatctaatggtccaaacattttttttcccttttctccgattaatataggttttagcctccagagcaaatgtggtagcttccatttaagctatcttaataatacaatacaatatatatatagatcaactgtttgtagattaatataggtcaaacgctgtcactattacaaatgtatattatcagtacactttcagtaaatcattagtgccgcttttgtgctgtgtatgacaagaataactaaatttaaaattttagcttgttttcaattcgcttttctttataatgtagaacaactatcaggaatatgtgaacttgaaggcacatgttgagattctgcaacaatcacaaaggtaatagattctttatgttcatactcatatgtacatgtgttcttcaattttgttgggtctaatattttagtctaaagaacactggctctactccattgctccctttgttttgcaaaatattttaactggtgataatgttgcaggaaccttctaggtgaggatttagctccactggctacaaatgaacttgagcagcttgagagtcaagtagtcagaaccttgaagcaaatcagatcaagaaaggtaaattaacatagcaaggaaactcgttcaagtataaatatgtagtatacttaccgattaaaattttcagatttcatccgtaacgttgcgctagcttctttgttacatatattatggtttgcttactatgcactatatctgaagctatacaaatgtggtaatatgtgatgtggatttgtatttgttggcttacccaacatccatgtgataaaagatcaatgttctacgaggcttaacccttagttgttgtgttgcttaagcttaattagaataatttacaaaggttggattaaattaaaagtgggattttctgactaggagttgtgaataacaagtaactgtaacgttaaaaaaaaagtaactgcattttgccacactgatactccctccgttcttaaaaaaaaaaaactcaacctaaacaaggatgtgacatatcttagtataataaatctagacagccctttgtccagattcgttgtcctaaaaaatgtcatatcccctcctaggtttagtttttttttacagagggagtacattgctgtacacttggtgactgccaattgattagaaaaggtgcaactatttgctttcctttttttcattaaaaaaattaagggatatatattattctctacgattcaaaaagctgctccaagctaggtgacttctaatactcttctgtgcatgatttcatacatattttgcagactcaggtactacttgatgaactctgcgacctaaagagaaaggtaacactgaaatatcttcttcaatgccgccaaatgatatactacactacagtgaatacttgtacctctttcagtggcaaattcggtttgtttttatctaattgctccaatattgaacttttcttcaggaacaaatgctacaagatgcaaacagggtcctgaaaaggaaggtacgagatttccatttactcaaatgctacctagaaaccatatagaaaaagctccctctgcatttgtagttagggaccgcatgactcgcttcttggaccactcccaagaattttgctcgatctcctctgaagtagatttgtgggctcgtgattgaaaagccgatgatgcacaagtaggccaagtatatataggtcggtaggtccccccggctggtggcatggcagcagtataaaatgcatgcatcggcttctcagccttcacctctctgcatcaatttgacatcatgctatttggagaacgcacatgtttcttgatcatgatcattctctgtagtgatcggcagtgacaacgttgctcttctcttggttaatttggttgtttgatcctttcctgtttcagcttgacgagatcgacgtagaggcagctcccccacagcctccatggaacggaaactgcagcaatggccatggcggcggcggcggcgtgttttccagtgagcctccccaaccagagcacttcttccaggccctcgggtgcgtgaactgcactgtcttcatccttgctaaacttttgttagaaaaagggagatttctacactctttttgacaaatggagctttcatttagaaggggaaaaaaatcattaattccgcttttgcaccaaacaagttagttttccacggattatcaagatttgtcctaataatggcaaagtgatggttgtctatatatgaatcatgttggactgatggcaaatatgcacttgctaatttttgcaggcttcatgccgtggacgtgaaccagccgccggcgccgccaccgggcggttatcctcctgagtggatggcctagctagctagctagctaccgtttcagcttcagttaatcagggtcaagtatcagctgagtttggccatatgtatggattctatatgttgcttcagaagttcctctctccttcctcttcaatttgttgctaattaagtgcttgccaaacttttctcagtgtaatgtactactactatgtatagttttgtcttgtatgaacagtttgtgagtactgtcactgcgagtaaggtgcgtgatatggtaccgtgaaaacaaaagcgggacaaccatcctttttgcgttt</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0753100, RefSeq:Os03g0753100