Difference between revisions of "Os09g0439200"

From RiceWiki
Jump to: navigation, search
(→‎Function)
(→‎Annotated Information)
Line 1: Line 1:
 
Please input one-sentence summary here.
 
Please input one-sentence summary here.
−
 
−
==Annotated Information==
 
−
===Function===
 
−
OsJAZ8 is a rice jasmonate ZIM-domain protein and acts as a repressor of JA signaling in rice.OsJAZ8 negatively regulates the JA-induced resistance toXooin rice. OsJAZ8exhibited the highest up-regulation among the JA-responsiveJAZ genes in rice. OsJAZ8 interacted with OsCOI1H, which is a component of the SCF complex,in a coronatine-dependent manner and was degraded via the 26S proteasome pathway in a COR-dependent manner. Furthermore, the JA-dependent OsJAZ8 degradation was mediated by the Jas domain. OsJAZ8 may function as a heterodimer with other JAZ proteins to repress JA signaling in rice, but did not form homodimer<ref name="ref1" />.
 
−
 
−
===Expression===
 
−
OsTIFY family genes had distinct expression patterns.OsTIFY10c showed high expression in the callus and leaves.
 
−
qRT–PCR analysis of JAZ genes in rice after treatment with 100mM JA for 24 h, EightJAZ genes (OsJAZ 1, 3, 4, 7, 8, 9, 10and 12) were significantly up-regulated by JA, with OsJAZ8 exhibiting the highest up-regulation among the JA-responsive JAZ genes in rice (Fig. 2A). After JA treatment, OsJAZ8 expression reached a maximum level at 24 h in the tested period (Fig. 2B). However, after inoculation with virulent Xoo, OsJAZ8 expression was not up-regulated in the tested period (Fig. 2C).When the Jas domain-truncated OsJAZ8 (OsJAZ8�C) was
 
−
overexpressed in rice, the transgenic rice plants exhibited
 
−
JA-insensitive phenotypes, such as resistance to JA-induced inhibition of root growth and inhibition of JA-induced Chl reduction. These results indicate that expression of OsJAZ8�C
 
−
inhibits JA responsiveness via the dominant-negative activity
 
−
of the altered OsJAZ8 protein.
 
−
 
−
===Evolution===
 
−
JAZ (JASMONATE ZIM-DOMAIN) is a subfamily of TIFY. The 12 members of this subfamily contain the TIFY domain and a C-terminal conserved domain designated as Jas which has a characteristic motif of SLX2FX2KRX2RX5PY (reviewed by Staswick2008).
 
−
 
−
The TIFY family owes its name to a conserved TIFY domain with a highly conserved amino acid pattern of TIF [F/Y]XG in the protein sequences.
 
−
To analyze the evolutionary relationships of theOsTIFY
 
−
genes, a phylogenetic tree was generated using the
 
−
sequence alignments of 38 full-length TIFY proteins,
 
−
including 20 from rice and 18 from ''Arabidopsis thaliana''. The 38 TIFY proteins were also classified into two
 
−
major groups (I and II) according to the unrooted phylogenetic tree (Fig.1). Four proteins with the GATA zincfinger and CCT domains (OsTIFY1a, 1b, 2a, and 2b) were
 
−
clustered together in group I. The proteins without the
 
−
GATA zinc-finger and CCT domains consist of the second
 
−
major group (group II), and this group contains all the JAZ gene cluster (OsTIFY11e, OsTIFY11f, and OsTIFY11d)on
 
−
chromosome 10. Among the 20OsTIFYgenes, 16 members are located either in tandem duplication (11a, 11b, and
 
−
11c; 1aand1b, and 11e, 11f, and 11d) or in the duplicated
 
−
segmental regions of rice chromosomes (2a, 2b, 6a, 6b,
 
−
10a, 10b, 11a, 11b, 11c, 11d, 11e, 11f, 11g, and 5; Fig. 1).
 
−
Only fourOsTIFYmembers (OsTIFY3, 8, 9,and10c) are
 
−
located in nonduplication regions.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==

Revision as of 09:47, 23 May 2014

Please input one-sentence summary here.

Labs working on this gene

Please input related labs here.

References

<references>

  • <ref name="ref1">Shoko Yamada;Akihito Kano;Daisuke Tamaoki;Ayumi Miyamoto;Hodaka Shishido;Seika Miyoshi;Shiduku Taniguchi;Kazuya Akimitsu;Kenji Gomi
 Involvement of OsJAZ8 in Jasmonate-Induced Resistance to Bacterial Blight in Rice
 Plant and Cell Physiology, 2012, 53(12): 2060-2072

Structured Information

Gene Name

Os09g0439200

Description

ZIM domain containing protein

Version

NM_001069808.1 GI:115479358 GeneID:4347164

Length

1747 bp

Definition

Oryza sativa Japonica Group Os09g0439200, complete gene.

Source

Oryza sativa Japonica Group 

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 9

Location

Chromosome 9:16927233..16928979

Sequence Coding Region

16927643..16927760,16927878..16927935,16928082..16928272,16928493..16928643,16928730..16928910

Expression

GEO Profiles:Os09g0439200

Genome Context

<gbrowseImage1> name=NC_008402:16927233..16928979 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008402:16927233..16928979 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggccggccgtgcgacggcgacggcgacggcggcggggaaggacaggtccagcttcgccgtcacctgtagcctcctcagccagtttctcaaggagaagaagggcggcggcggcgggctgcaggggctcggcctcggcttgcggccggcgccggcggcgccgcccgccgcgggagctggaggtgctttccggccgccgccgaccaccatgaacttgctgtcggggctcgacgcgccggcggtggaggtggagccaaacacggcggaaacagcggccgacgagctgcctctcatcaaggccccggccgatcagcaaagcgacgaaagtgcaagtgaggcagctggagagaaggctcaacagctgaccatcttctacggtggaaaagtagtcgtctttgagaacttcccgtccaccaaggtcaaggatctcttacaaatcgtaagcacaggcgatggcgtcgacaagaacaccggcaccgcggcaacgcagagcctgccccgacccgcacacaacagtcttcccgatctgccgattgcaaggaggaactcgctccataggtttctcgagaagagaaagggcaggatgaatgcaaatgctccataccaagctaactgcaccgctgcaccgtccaagcaagctaacggtgacaaatcttggcttgggtttggccaagagatgacaataaagcaggagatatga</cdnaseq>

Protein Sequence

<aaseq>MAGRATATATAAGKDRSSFAVTCSLLSQFLKEKKGGGGGLQGLG LGLRPAPAAPPAAGAGGAFRPPPTTMNLLSGLDAPAVEVEPNTAETAADELPLIKAPA DQQSDESASEAAGEKAQQLTIFYGGKVVVFENFPSTKVKDLLQIVSTGDGVDKNTGTA ATQSLPRPAHNSLPDLPIARRNSLHRFLEKRKGRMNANAPYQANCTAAPSKQANGDKS WLGFGQEMTIKQEI</aaseq>

Gene Sequence

<dnaseqindica>1220..1337#1045..1102#708..898#337..487#70..250#agagagagacaaccagacgggagcttgtcggggaggagagagagagagagtggtggtggtggtggtgagatggccggccgtgcgacggcgacggcgacggcggcggggaaggacaggtccagcttcgccgtcacctgtagcctcctcagccagtttctcaaggagaagaagggcggcggcggcgggctgcaggggctcggcctcggcttgcggccggcgccggcggcgccgcccgccgcgggagctggaggtaataagcgattgtgttcgtcatgcgattaaattagcagcgacttgttttgtttcttaccacgtatggggtgttggtctttgcaggtgctttccggccgccgccgaccaccatgaacttgctgtcggggctcgacgcgccggcggtggaggtggagccaaacacggcggaaacagcggccgacgagctgcctctcatcaaggccccggccgatcagcaaagcgacgaaagtgcaaggtacaaacaatctctagtacactctgcatcctgacatctcacgatctcaaacaaactctctcctgttcattaaaaaagagtagtaaaatgaacataaaacatgttatcctgacttgcaacttgcatccttatacaatgtctagaagaagaagaaaacacacttaattttttggagtagagataatttggttgcaactgtctctttggttctttcttccagtgaggcagctggagagaaggctcaacagctgaccatcttctacggtggaaaagtagtcgtctttgagaacttcccgtccaccaaggtcaaggatctcttacaaatcgtaagcacaggcgatggcgtcgacaagaacaccggcaccgcggcaacgcagagcctgccccgacccgcacacaacagtcttcccggtaataacaactgttcattcttttgcagttttacattttaccatcacagtgctaattaatttccatctactatgcttaaatttatctactacatgtgaaacaatgtaggaatccttaacgaatgactgatttttgatttgttacagatctgccgattgcaaggaggaactcgctccataggtttctcgagaagagaaagggcaggtaggtaactgagtggctttcaacttctatctgaaatacttgcctttcgctgtcaaaaactggctgtcagaccaagtttatggccctaaaattctccatgctcttcaaccactccaggatgaatgcaaatgctccataccaagctaactgcaccgctgcaccgtccaagcaagctaacggtgacaaatcttggcttgggtttggccaagagatgacaataaagcaggagatatgatatgacctcttagcttacagttcactgtcaagtgtcaagtgatctgtggggaagagatgcgtggttggctggttgctagtgctagtgtattcccccgtagcttcaaagcatgaataattactcaatactactacattactactagtaagaacttaatcaatactaggaatcaagctggtggttaattctgcctgaccattggcatcctggaatatatataagcacacacacgggttgtttgttctccacattgtttgctgctggagccgtatgctcactgcagtttatatctgtctagctggttacccacctcagcctcaccatgtttcgggaataaacactgtgtatgtgcaaattcttcatttctcgttcggtttcgccgtataaattacattgttactattttggct</dnaseqindica>

External Link(s)

NCBI Gene:Os09g0439200, RefSeq:Os09g0439200

Retrieved from "https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os09g0439200&oldid=171179"