Difference between revisions of "Os04g0271200"
(→Expression) |
(→Function) |
||
| Line 6: | Line 6: | ||
The SILENT INFORMATION REGULATOR2 (SIR2) family proteins are NAD +-dependent histone deacetylases. Sir2 is involved in chromatin silencing at the mating-type loci, rDNA, and telomeres in yeast and is associated with lifespan extension in yeast, worms, and flies, but also in a broader range of additional functions[1]. | The SILENT INFORMATION REGULATOR2 (SIR2) family proteins are NAD +-dependent histone deacetylases. Sir2 is involved in chromatin silencing at the mating-type loci, rDNA, and telomeres in yeast and is associated with lifespan extension in yeast, worms, and flies, but also in a broader range of additional functions[1]. | ||
The SIR2 family has two members in rice: SRT701 and SRT702[2]. The two proteins are likely to have distinct functions, as SRT701 (OsSRT1) is nuclear localized and is shown to be involved in histone H3K9 deacetlyation required for transposon repression in rice[1], whereas SRT702 is recently shown to be localized in the mitochondria[3]. | The SIR2 family has two members in rice: SRT701 and SRT702[2]. The two proteins are likely to have distinct functions, as SRT701 (OsSRT1) is nuclear localized and is shown to be involved in histone H3K9 deacetlyation required for transposon repression in rice[1], whereas SRT702 is recently shown to be localized in the mitochondria[3]. | ||
| − | SRT1 is a widely expressed nuclear protein with higher levels in rapidly dividing tissues. SRT1 RNA interference induced an increase of histone H3K9 (lysine-9 of H3) acetylation and a decrease of H3K9 dimethylation, leading to H2O2 production, DNA fragmentation, cell death, and lesions mimicking plant hypersensitive responses during incompatible interactions with pathogens, whereas overexpression of SRT1 enhanced tolerance to oxidative stress[1]. | + | SRT1 is a widely expressed nuclear protein with higher levels in rapidly dividing tissues. SRT1 RNA interference induced an increase of histone H3K9 (lysine-9 of H3) acetylation and a decrease of H3K9 dimethylation, leading to H2O2 production, DNA fragmentation, cell death, and lesions mimicking plant hypersensitive responses during incompatible interactions with pathogens, whereas overexpression of SRT1 enhanced tolerance to oxidative stress. Rice SIR2-like gene is required for safeguard against genome instability and cell damage to ensure plant cell growth[1]. |
SRT2 resides predominantly at the inner mitochondrial membrane and interacts with a small number of protein complexes mainly involved in energy metabolism and metabolite transport.SRT2 is important in fine-tuning mitochondrial energy metabolism.[4] | SRT2 resides predominantly at the inner mitochondrial membrane and interacts with a small number of protein complexes mainly involved in energy metabolism and metabolite transport.SRT2 is important in fine-tuning mitochondrial energy metabolism.[4] | ||
Revision as of 15:59, 23 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here. The SILENT INFORMATION REGULATOR2 (SIR2) family proteins are NAD +-dependent histone deacetylases. Sir2 is involved in chromatin silencing at the mating-type loci, rDNA, and telomeres in yeast and is associated with lifespan extension in yeast, worms, and flies, but also in a broader range of additional functions[1]. The SIR2 family has two members in rice: SRT701 and SRT702[2]. The two proteins are likely to have distinct functions, as SRT701 (OsSRT1) is nuclear localized and is shown to be involved in histone H3K9 deacetlyation required for transposon repression in rice[1], whereas SRT702 is recently shown to be localized in the mitochondria[3]. SRT1 is a widely expressed nuclear protein with higher levels in rapidly dividing tissues. SRT1 RNA interference induced an increase of histone H3K9 (lysine-9 of H3) acetylation and a decrease of H3K9 dimethylation, leading to H2O2 production, DNA fragmentation, cell death, and lesions mimicking plant hypersensitive responses during incompatible interactions with pathogens, whereas overexpression of SRT1 enhanced tolerance to oxidative stress. Rice SIR2-like gene is required for safeguard against genome instability and cell damage to ensure plant cell growth[1]. SRT2 resides predominantly at the inner mitochondrial membrane and interacts with a small number of protein complexes mainly involved in energy metabolism and metabolite transport.SRT2 is important in fine-tuning mitochondrial energy metabolism.[4]
Expression
Please input expression information here. The SILENT INFORMATION REGULATOR2 (SIR2) family proteins are NAD +-dependent histone deacetylases. Sir2 is involved in chromatin silencing at the mating-type loci, rDNA, and telomeres in yeast and is associated with lifespan extension in yeast, worms, and flies, but also in a broader range of additional functions[1]. The SIR2 family has two members in rice: SRT701 and SRT702[2]. The two proteins are likely to have distinct functions, as SRT701 (OsSRT1) is nuclear localized and is shown to be involved in histone H3K9 deacetlyation required for transposon repression in rice[1], whereas SRT702 is recently shown to be localized in the mitochondria[3]. SRT1 is a widely expressed nuclear protein with higher levels in rapidly dividing tissues. SRT1 RNA interference induced an increase of histone H3K9 (lysine-9 of H3) acetylation and a decrease of H3K9 dimethylation, leading to H2O2 production, DNA fragmentation, cell death, and lesions mimicking plant hypersensitive responses during incompatible interactions with pathogens, whereas overexpression of SRT1 enhanced tolerance to oxidative stress. Rice SIR2-like gene is required for safeguard against genome instability and cell damage to ensure plant cell growth[1]. SRT2 resides predominantly at the inner mitochondrial membrane and interacts with a small number of protein complexes mainly involved in energy metabolism and metabolite transport.SRT2 is important in fine-tuning mitochondrial energy metabolism.[4]
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os04g0271200 |
|---|---|
| Description |
Silent information regulator protein Sir2 family protein |
| Version |
NM_001058879.1 GI:115457487 GeneID:4335343 |
| Length |
2712 bp |
| Definition |
Oryza sativa Japonica Group Os04g0271200, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 4:11382902..11385613 |
| Sequence Coding Region |
11382931..11383001,11383087..11383198,11383743..11383761,11384020..11384108,11384528..11384581 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008397:11382902..11385613 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008397:11382902..11385613 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcgggcgtcgggtcggcggtgcggcggctctacctctccgtttacaactgggccgtcttcttcggatgggcgcaggtgctgtactacgcggtcacgacgctgctggagagcggccatgaggccgtctacgccgccgtcgagcggccgctgcagttcgcgcagaccgccgccttcttggagattcttcatgggcttgtaggtttggtgaggtctccagtctctgcaactcttccacaaattggatcgaggttgtttcttacctggggcatcctgtggagctttccagagacacattcacatatccttgttacttccttggtcataagctggtccatcactgagatcattagatattccttctttggcatgaaggaggcattcggatttgctccttcctggctcttatggctgaggtatagcacctttatggtattgtatcctactggtatcagcagtgaggtcggtttaatctacattgccttgccttacatgaaggcatcagagaaatactgccttaggatgcccaacaaatggaacttctcctttgatttcttctatgcatccatcctttctctcgccatctacgtgcccggatcgcctcacatgttcacctacatgcttgcccaacggaagaaggcattggcaaaggctaaggctgcataa</cdnaseq> |
| Protein Sequence |
<aaseq>MAGVGSAVRRLYLSVYNWAVFFGWAQVLYYAVTTLLESGHEAVY AAVERPLQFAQTAAFLEILHGLVGLVRSPVSATLPQIGSRLFLTWGILWSFPETHSHI LVTSLVISWSITEIIRYSFFGMKEAFGFAPSWLLWLRYSTFMVLYPTGISSEVGLIYI ALPYMKASEKYCLRMPNKWNFSFDFFYASILSLAIYVPGSPHMFTYMLAQRKKALAKA KAA</aaseq> |
| Gene Sequence |
<dnaseqindica>30..100#186..297#842..860#1119..1207#1627..1680#1831..1901#2005..2086#2186..2282#2403..2473#ccttgttagctactgctgagtgctcggcgatggcgggcgtcgggtcggcggtgcggcggctctacctctccgtttacaactgggccgtcttcttcggatggtactctgccgcctcgcgccaccgcctgctggcgtttggatccttgttttcttggcttgatttgggggtttcttggatcttgcagggcgcaggtgctgtactacgcggtcacgacgctgctggagagcggccatgaggccgtctacgccgccgtcgagcggccgctgcagttcgcgcagaccgccgccttcttggaggtctggtttttctgctattctgtgcgctctgacttatttttgaattttaatcgcagtaaaactgtagattttagcgcaagcttgtataatttgggcagctctgacttaattttgaatttttcgtctacccaattagggttgctggtgttgagcaatggcacagaggaaaaaaatttatccccttttgcgttctaaaaatcaaccaaacatttagcctgagagaaatattaccagtgttatagcaaaatatactgcaattaattcaacttcaatgttattatgtttctgctgcctgatcctctcccccgataattctgctaaaaagaaaagaaaaatttctgctgccctatactttgtgttaaattccttgtagttccctggataaggaagcatttatattctttgcacggagcagctgaacgagtctgcggtgaacacagaatgaacgagtattccatgtttatttcatttctttgcaaattgtgttttgtgaggtactgaacatttttgtgtttgtttggcgatggcgttgctggtggctcagattcttcatgggcttgtaggtaagaagttgttcttctcttctacttatgttattttcactatccttgtcatcatttggaatcgtacggtttctgtctatagcgtgccgcttgcaaactgcatggaaatagactttcttgttagaaagcacgtcaaagacacatttcaatttacaggaagtgtcctgttagattatgaaaataattgtacttaataagttcacttttacggcactttcatttttttcacctgtataacatgctgactttgttttaaaggtttggtgaggtctccagtctctgcaactcttccacaaattggatcgaggttgtttcttacctggggcatcctgtggagctttccagaggtatcatcgactatcactaacaagtgttgatgtgctatgttcatgagatttggaaattttcttctttagttagacacttctcctaagcgcttactgtttctccgagacattgaaacatgacataattttggggtttaaaaccattgtctaaataggaaatatggattatatgatttgatttttatatgaggacaggacactaggtagtttgtctgttttatatctggttgtggatcaagtaaataatggtgatgattgtacaagttactaaatggcataactactggtactgatatgcaaatgcagtgcctttacttttgcatccctagttttctgttagttgcatacttgtagtgtagcttaacacctggtttcttgacatatatattgattgacccctttgtacatttgtcttgcagacacattcacatatccttgttacttccttggtcataagctggtccatcactgaggtatattttaaagacttgcttcttaaagagacactgtattttccaaattctaattttgatttttcctgtgctaagcttattcacaccaatatttaaaatattgtgaatttgatagcataacgtgatggaaatatttgtggttccttgcagatcattagatattccttctttggcatgaaggaggcattcggatttgctccttcctggctcttatggctgaggttagtaaagaagatatatcattatttaggacaaatttagagggaatgattttctttttctttcataactttttttcttaaacctggtgctgattttgtacaggtatagcacctttatggtattgtatcctactggtatcagcagtgaggtcggtttaatctacattgccttgccttacatgaaggtaacaagaatgaacttcagaaatgaagatctccacgttgttcattgcataatgcataatgcgtaatttaactgctcctttcttgtgactactatgcaggcatcagagaaatactgccttaggatgcccaacaaatggaacttctcctttgatttcttctatgcatccatcctttctctcgccatctacgtgcccggtatcccctcctgccttgcagtcatcctttattcagtggttgaaattaaaactagaattgcaatgttgttttttagtagctgggattaagataggatctgacaagaacactgcgttgcaggatcgcctcacatgttcacctacatgcttgcccaacggaagaaggcattggcaaaggctaaggctgcataatggtgatgctcaagagctttcttgaatttttcatgtgtggcttaaggatctgcctaaatagctcatatttgctactcttttagtacaagtctgtagatgaggaaatgttggaaagaactactatcttaatcccagcatttgttgtaactgtagtaactgcccatcatttgttgtaactgtagtcttctaccaagaattgtatgatattttacctggttaaattattgaatgattgatcc</dnaseqindica> |
| External Link(s) |