Difference between revisions of "Os04g0673300"
| Line 14: | Line 14: | ||
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2]. | Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2]. | ||
[[File:fig3]] | [[File:fig3]] | ||
| − | + | Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses. | |
===Expression=== | ===Expression=== | ||
Please input expression information here. | Please input expression information here. | ||
Revision as of 17:47, 23 May 2014
Please input one-sentence summary here. OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].
Contents
Annotated Information
Function
Please input function information here. OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1]. The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1]. Overexpression of OsRR6 also affected the expression of CK-responsive genes[2]. OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2]. File:Fig1 Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter (Zhang et al. 1991, Sentoku et al.2000). Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2]. File:Fig2 Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2]. File:Fig3 Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here. 1.Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. 3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696 4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707
Structured Information
| Gene Name |
Os04g0673300 |
|---|---|
| Description |
Similar to ZmRR2 protein (Response regulator 2) |
| Version |
NM_001060766.1 GI:115461261 GeneID:4337372 |
| Length |
1115 bp |
| Definition |
Oryza sativa Japonica Group Os04g0673300, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 4:34775847..34776961 |
| Sequence Coding Region |
34775949..34776305,34776410..34776565 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008397:34775847..34776961 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008397:34775847..34776961 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga</cdnaseq> |
| Protein Sequence |
<aaseq>MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS DVSRLCSRIR</aaseq> |
| Gene Sequence |
<dnaseqindica>103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc</dnaseqindica> |
| External Link(s) |