Difference between revisions of "Os04g0673300"

From RiceWiki
Jump to: navigation, search
(Function)
(Expression)
Line 29: Line 29:
  
 
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)((L. Du et al.2007). OsRR6 was expressed mostly in roots and leaves.
 
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)((L. Du et al.2007). OsRR6 was expressed mostly in roots and leaves.
 +
 
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)(L. Du et al.2007).
 
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)(L. Du et al.2007).
  

Revision as of 18:05, 23 May 2014

Please input one-sentence summary here. OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].

Annotated Information

Function

Please input function information here. OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions.

The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].

The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].

Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].

OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2]. File:Fig1

Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter (Zhang et al. 1991, Sentoku et al.2000). Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2]. File:Fig2

Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2]. File:Fig3

Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.

Expression

Please input expression information here. OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 (Fig. 4)(L. Du et al.2007). File:Fig4

The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)((L. Du et al.2007). OsRR6 was expressed mostly in roots and leaves.

The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)(L. Du et al.2007).

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here. 1.Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. 3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696 4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707

Structured Information

Gene Name

Os04g0673300

Description

Similar to ZmRR2 protein (Response regulator 2)

Version

NM_001060766.1 GI:115461261 GeneID:4337372

Length

1115 bp

Definition

Oryza sativa Japonica Group Os04g0673300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:34775847..34776961

Sequence Coding Region

34775949..34776305,34776410..34776565

Expression

GEO Profiles:Os04g0673300

Genome Context

<gbrowseImage1> name=NC_008397:34775847..34776961 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:34775847..34776961 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga</cdnaseq>

Protein Sequence

<aaseq>MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS DVSRLCSRIR</aaseq>

Gene Sequence

<dnaseqindica>103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0673300, RefSeq:Os04g0673300