Difference between revisions of "Os07g0616800"

From RiceWiki
Jump to: navigation, search
(characteristic)
(characteristic)
Line 3: Line 3:
 
   The current work confirms that six genes comprise the entire rice Sucrose synthase (SUS) gene family [[File:The Sus gene family in rice.jpg|right|thumb|150px|''picture1. Rice Sus gene family is comprised of six genes (from reference <ref name="ref1" />).'']]. It is obvious to note that each of the SUS genes is present on a separate chromosome, except SUS1 and 4 which are both located on chromosome. SUS3 is situated on chromosome 7.
 
   The current work confirms that six genes comprise the entire rice Sucrose synthase (SUS) gene family [[File:The Sus gene family in rice.jpg|right|thumb|150px|''picture1. Rice Sus gene family is comprised of six genes (from reference <ref name="ref1" />).'']]. It is obvious to note that each of the SUS genes is present on a separate chromosome, except SUS1 and 4 which are both located on chromosome. SUS3 is situated on chromosome 7.
 
   Analysis of gene structure for the six rice Sus genes [[File:Gene structure of the six SUS genes.jpg|right|thumb|150px|''picture2. Analysis of gene structure for the six rice Sus genes (from reference <ref name="ref1" />).'']] revealed that the genes typically consist of 14 or 15 exons. SUS3 is consisted of 15 exons similar to SUS2 and SUS4.
 
   Analysis of gene structure for the six rice Sus genes [[File:Gene structure of the six SUS genes.jpg|right|thumb|150px|''picture2. Analysis of gene structure for the six rice Sus genes (from reference <ref name="ref1" />).'']] revealed that the genes typically consist of 14 or 15 exons. SUS3 is consisted of 15 exons similar to SUS2 and SUS4.
   Properties of the six predicted rice Sus proteins are shown in picture. 3. [[File:Comparison of the predicted rice Sus proteins as deduced from their cDNA sequences.jpg|right|thumb|150px|''picture3. Properties of the six predicted rice Sus proteins (from reference <ref name="ref1" />).'']]. A multiple sequence alignment analysis of the six rice sequences with Sus peptide sequences from other plant species revealed that the six rice Sus peptides can be classified into the three groups as suggested by Komatsu et al., namely Sus1 group (SUS1, 2 and 3), SusA group (SUS4), New Group (NG;SUS5 and 6). The predicted molecular weights of the six polypeptides are very close ranging from 92.1 to 96.5 kDa, with SUS3 being 93.2kDa. High levels of similarity exist between the predicted amino acid sequences of SUS1-4, ranging between 89 and 68%. The similarity between SUS3 and SUS1, SUS2, SUS4, SUS5 SUS6 are 89%, 79%, 68%, 53%, 52%, respectively. The predicted isoelectric point of SUS3 is somewhat lower (pI 5.94) than those of the other family members which range from 6.03 (SUS6) to 7.73 (SUS5) except indistinguishably with SUS2 (pI 5.93).
+
   Properties of the six predicted rice Sus proteins are shown in picture. 3. [[File:Comparison of the predicted rice Sus proteins as deduced from their cDNA sequences.jpg|right|thumb|150px|''picture3. Properties of the six predicted rice Sus proteins (from reference <ref name="ref1" />).'']] A multiple sequence alignment analysis of the six rice sequences with Sus peptide sequences from other plant species revealed that the six rice Sus peptides can be classified into the three groups as suggested by Komatsu et al., namely Sus1 group (SUS1, 2 and 3), SusA group (SUS4), New Group (NG;SUS5 and 6). The predicted molecular weights of the six polypeptides are very close ranging from 92.1 to 96.5 kDa, with SUS3 being 93.2kDa. High levels of similarity exist between the predicted amino acid sequences of SUS1-4, ranging between 89 and 68%. The similarity between SUS3 and SUS1, SUS2, SUS4, SUS5 SUS6 are 89%, 79%, 68%, 53%, 52%, respectively. The predicted isoelectric point of SUS3 is somewhat lower (pI 5.94) than those of the other family members which range from 6.03 (SUS6) to 7.73 (SUS5) except indistinguishably with SUS2 (pI 5.93).
  
 
===Function===
 
===Function===

Revision as of 03:29, 24 May 2014

Please input one-sentence summary here.

characteristic

The current work confirms that six genes comprise the entire rice Sucrose synthase (SUS) gene family
picture1. Rice Sus gene family is comprised of six genes (from reference [1]).
. It is obvious to note that each of the SUS genes is present on a separate chromosome, except SUS1 and 4 which are both located on chromosome. SUS3 is situated on chromosome 7. Analysis of gene structure for the six rice Sus genes
picture2. Analysis of gene structure for the six rice Sus genes (from reference [1]).
revealed that the genes typically consist of 14 or 15 exons. SUS3 is consisted of 15 exons similar to SUS2 and SUS4. Properties of the six predicted rice Sus proteins are shown in picture. 3.
picture3. Properties of the six predicted rice Sus proteins (from reference [1]).
A multiple sequence alignment analysis of the six rice sequences with Sus peptide sequences from other plant species revealed that the six rice Sus peptides can be classified into the three groups as suggested by Komatsu et al., namely Sus1 group (SUS1, 2 and 3), SusA group (SUS4), New Group (NG;SUS5 and 6). The predicted molecular weights of the six polypeptides are very close ranging from 92.1 to 96.5 kDa, with SUS3 being 93.2kDa. High levels of similarity exist between the predicted amino acid sequences of SUS1-4, ranging between 89 and 68%. The similarity between SUS3 and SUS1, SUS2, SUS4, SUS5 SUS6 are 89%, 79%, 68%, 53%, 52%, respectively. The predicted isoelectric point of SUS3 is somewhat lower (pI 5.94) than those of the other family members which range from 6.03 (SUS6) to 7.73 (SUS5) except indistinguishably with SUS2 (pI 5.93).

Function

SUS3andSUS4were predominantly expressed in the caryopsis, indicating potential roles in carbon allocation within the filling grain.

Distribution

Expression

Please input expression information here.

Nucleotide Polymorphisms

Allele Distribution

Haplotype Diversity

Recombination

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os07g0616800

Description

Sucrose synthase 3 (EC 2.4.1.13) (Sucrose-UDP glucosyltransferase 3)

Version

NM_001066813.1 GI:115473358 GeneID:4343910

Length

5494 bp

Definition

Oryza sativa Japonica Group Os07g0616800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:26089796..26095289

Sequence Coding Region

26090755..26090864,26091410..26091539,26091635..26091786,26091872..26092064,26092242..26092360
,26092448..26092664,26092775..26092870,26092986..26093159,26093267..26093383
,26093479..26093645,26093724..26093948,26094036..26094354,26094440..26094684
,26094779..26094917,26095014..26095061

Expression

GEO Profiles:Os07g0616800

Genome Context

<gbrowseImage1> name=NC_008400:26089796..26095289 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:26089796..26095289 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgggggaaactactggagaacgtgccctgacccgtctccacagcatgagggagcgcatcggcgattccctctccgcgcacaccaatgagcttgtggctgtcttctcaaggcttgtgaaccaaggaaagggaatgctacagccccaccagatcattgctgagtacaacgccgcaatccctgagggcgagcgtgagaagctgaaggactctgccttagaggatgtcctgaggggagcacaggaggcgattgtcatccctccatggattgcccttgccattcgcccaaggcctggtgtctgggagtatctgaggatcaatgtaagccagcttggtgttgaggagctgagtgtccctgaatacttgcagttcaaggagcagcttgtggatggaagcacccagaacaactttgtgcttgagctggactttgagccattcaatgcctccttccctcgcccatcgttgtcgaagtctattggcaatggggtgcagttcttgaacaggcacctgtcgtcaaagctgttccatgacaaagagagcatgtaccccctgctcaactttcttcgtgcgcacaactacaaagggatgaccatgatgttgaacgacaggattcgcagtctcgatgctctccaaggtgcattgaggaaggcagaaaaacatcttgcaggcattacagctgacaccccatattcagagttccatcacaggttccaagagcttggtttggagaagggttggggtgactgcgctcagcgagtgcgtgagactattcaccttctcttggaccttcttgaggcccctgagccgtccgccttggagaagttccttggaacaatcccaatggtgttcaatgttgttatcctctccccgcatggttactttgcacaggctaatgtcttggggtaccctgataccggtgggcaggttgtctacattttggatcaagtccgtgctatggagaatgagatgctgctgaggatcaagcaacaaggtctaaacatcacaccaaggattctcattgtgaccaggttgctacctgatgcgcatggcaccacatgtggccagcgccttgagaaggtcctaggcactgagcacactcatatcctgcgtgtgccattccgaacagaaaatgggactgttcgcaaatggatctcgcgttttgaagtctggccttacctggaaacttacaccgatgatgtggcacacgagatttctggagagctgcaggccacccctgacctgatcattgggaactacagtgatggcaaccttgttgcatgtttgctggcacacaagttgggtgtcactcattgtacaatcgcccatgcacttgagaaaaccaagtaccccaactccgacctttactggaagaagtttgaggatcactatcacttctcctgccagttcacagctgacctgattgcaatgaaccatgctgacttcatcatcacaagtaccttccaggagattgctggaaacaaggaaactgtggggcagtatgagtctcacatggcattcacaatgcctggcctttatcgtgttgtccatggtatcgatgtctttgaccccaagttcaacatcgtctctcctggtgctgacatgtccatctacttcccattcaccgaatcacagaagaggctcacctctctccatttagagatagaggagctactcttcagtgatgttgaaaacactgagcacaagtttgttctgaaggacaagaagaagccaatcatcttctcgatggctaggctagaccatgtcaagaatttgactggtctggttgagttgtatggtcggaaccctcgcctgcaagagctagtaaaccttgtggttgtctgtggtgaccatggcaaggaatccaaggacaaagaagagcaggctgagttcaagaagatgtttaatctgatcgagcagtacaatttgaatggccacatccgctggatctccgctcagatgaaccgtgtccgcaatggtgagctctaccgctacatctgcgacatgaggggagcctttgtgcagcccgctctctatgaggcctttgggctaactgtgattgaggccatgacctgtggtcttccaacatttgcaactgcctatggtggtccagccgagatcatcgtgcacggcgtgtctggctaccacattgatccttaccagaacgacaaggcctcggcgctgctcgtggagttctttgagaagtgtcaggaagacccaaaccactggatcaagatctcgcagggtggacttcagcgcatcgaggagaagtacacatggaagctctactctgagaggctgatgactctctccggtgtctacggtttctggaagtatgtcaccaacctcgacaggcgtgagacacgccgctacctggagatgctgtacgccctcaagtaccgcaagatggctaccaccgttccattggccattgagggagaggcctccaccaaatga</cdnaseq>

Protein Sequence

<aaseq>MGETTGERALTRLHSMRERIGDSLSAHTNELVAVFSRLVNQGKG MLQPHQIIAEYNAAIPEGEREKLKDSALEDVLRGAQEAIVIPPWIALAIRPRPGVWEY LRINVSQLGVEELSVPEYLQFKEQLVDGSTQNNFVLELDFEPFNASFPRPSLSKSIGN GVQFLNRHLSSKLFHDKESMYPLLNFLRAHNYKGMTMMLNDRIRSLDALQGALRKAEK HLAGITADTPYSEFHHRFQELGLEKGWGDCAQRVRETIHLLLDLLEAPEPSALEKFLG TIPMVFNVVILSPHGYFAQANVLGYPDTGGQVVYILDQVRAMENEMLLRIKQQGLNIT PRILIVTRLLPDAHGTTCGQRLEKVLGTEHTHILRVPFRTENGTVRKWISRFEVWPYL ETYTDDVAHEISGELQATPDLIIGNYSDGNLVACLLAHKLGVTHCTIAHALEKTKYPN SDLYWKKFEDHYHFSCQFTADLIAMNHADFIITSTFQEIAGNKETVGQYESHMAFTMP GLYRVVHGIDVFDPKFNIVSPGADMSIYFPFTESQKRLTSLHLEIEELLFSDVENTEH KFVLKDKKKPIIFSMARLDHVKNLTGLVELYGRNPRLQELVNLVVVCGDHGKESKDKE EQAEFKKMFNLIEQYNLNGHIRWISAQMNRVRNGELYRYICDMRGAFVQPALYEAFGL TVIEAMTCGLPTFATAYGGPAEIIVHGVSGYHIDPYQNDKASALLVEFFEKCQEDPNH WIKISQGGLQRIEEKYTWKLYSERLMTLSGVYGFWKYVTNLDRRETRRYLEMLYALKY RKMATTVPLAIEGEASTK</aaseq>

Gene Sequence

<dnaseqindica>960..1069#1615..1744#1840..1991#2077..2269#2447..2565#2653..2869#2980..3075#3191..3364#3472..3588#3684..3850#3929..4153#4241..4559#4645..4889#4984..5122#5219..5266#agcatccatcggttctctgctctgttcatccatagagtttcctcctcttctcctttagtgcaaggtagagaagagcatgtgtgtgtgtgtgtgtgtgtgaactgtgaagtgcagagtgcttctgtagttctgtgttatgtccatagtgatcttgttaggattgttgctatggatgcatgatgttatggttgatctctgaattacagtagggacttttctgagatctctggattagtggggggtgctaaatttttttctggttgcatcagcttgggtttctggtattggtgtgggttcttgctctgaattttggttcagaatgtcgatttgtttgtgtttgttctctgaagttgagagtagctatgatccatccagcacagaactgcaggtcctgcctgccggctgcatatacaggacatgccattttgcaagctctgggcttatggtttctcttttggagttcttcttcttgcatgatctgtgttctctaacaaaggaagcaagatttagcaactttattcagagacaagaaaaggatctggcaaccttttgtttctgttttatcctactcgtaaagattgttatttaagcaaaaatttcccaaaagttttaaatataatttccatgatgtgccactctcatgtccttgaacctggcactcattatgggctcctcagaagtgctgtagctaatgtcactaatcttttgtatctttgttcatagtcttgtattttatgatgcttatccctttgtgctttccatgtttgatgtccaaatgtcatggcaatgtttttgacttctagtaggggttttagtacctttttgttagataagtacatccaaattctgtttatttattcaaaaatcattctgtttattcactgaaaacatttgtccattcaatggactcataaactgtctgtgtttttcaggcttgaggatccatctagaagatagcaatgggggaaactactggagaacgtgccctgacccgtctccacagcatgagggagcgcatcggcgattccctctccgcgcacaccaatgagcttgtggctgtcttctcaaggtttgcacttaaatccttctcattttaatttgtattgatctacaagtacaaagatctagttcaaatgatgcatattgattgctttgtttatctcaaagttatgctgatgttagctggataaagagtgcatttactacatgcccaatacaaccatgatcttagctgtaaattgttaagtctgatgatcaccccagaatatatctgctattatccattccgtcgtttctataatatcctttggtaactctcagtagaagtgcttttaatttttcagttggagagaacaatttctgacggtgatctgttttaattgttctgtatagtgtcaagaaatattcctgtatttccaatatagtgctttttacagttccatcatatcaatggattaacatatggaacaaaaaaaatatttaaatcggttctgtttgtttaaaaaaaaggaaaaaagtttttgttcattcccacaaaacaatacattttcgaatttcaagtaatacaaagttggtaaatctaaaataactgttgttatgcaattttctgttcaggcttgtgaaccaaggaaagggaatgctacagccccaccagatcattgctgagtacaacgccgcaatccctgagggcgagcgtgagaagctgaaggactctgccttagaggatgtcctgaggggagcacaggtttgcatcagcagaactcactgcactatcatgctgaatggtactcccaaatgttcagctctgatgtaaaaaaatgttgctggtttgttgtgcaggaggcgattgtcatccctccatggattgcccttgccattcgcccaaggcctggtgtctgggagtatctgaggatcaatgtaagccagcttggtgttgaggagctgagtgtccctgaatacttgcagttcaaggagcagcttgtggatggaaggtatctggagctgtgattttaaccaataccatgcttaaagttataccttagattcctgatttgacaatcatgtgattgttttcagcacccagaacaactttgtgcttgagctggactttgagccattcaatgcctccttccctcgcccatcgttgtcgaagtctattggcaatggggtgcagttcttgaacaggcacctgtcgtcaaagctgttccatgacaaagagagcatgtaccccctgctcaactttcttcgtgcgcacaactacaaagggatggtaggttacactttccgatttcttgatttgattaaccgatccatatatttactatgatttataaactagtgtgttgtctgaatccttgtattcattgcctttgccatgacaactggaactactactcattgctgaatcaagcggagtttgcaataacttatgtccgtcctttttcagaccatgatgttgaacgacaggattcgcagtctcgatgctctccaaggtgcattgaggaaggcagaaaaacatcttgcaggcattacagctgacaccccatattcagagttccatcacaggtactgcacaatcgtcatgcaatgtctgaccaaatagaagttactatcaatgcatatctgacaatgttctttcatcaataaatttaggttccaagagcttggtttggagaagggttggggtgactgcgctcagcgagtgcgtgagactattcaccttctcttggaccttcttgaggcccctgagccgtccgccttggagaagttccttggaacaatcccaatggtgttcaatgttgttatcctctccccgcatggttactttgcacaggctaatgtcttggggtaccctgataccggtgggcaggtaatatactatccagttctacgagctggaatgttacctctttatataattgaaaccaccaagagtccaagactgatgccccagttttcttatgtgatggcaacttacaggttgtctacattttggatcaagtccgtgctatggagaatgagatgctgctgaggatcaagcaacaaggtctaaacatcacaccaaggattctcattgtaagttttttatttgaacgtaaattctcattgtaagttcaatacccaataaggtcaattacaaccttgcactttaattgattccaaataatgaggcctttttggtattacataggtgaccaggttgctacctgatgcgcatggcaccacatgtggccagcgccttgagaaggtcctaggcactgagcacactcatatcctgcgtgtgccattccgaacagaaaatgggactgttcgcaaatggatctcgcgttttgaagtctggccttacctggaaacttacaccgatgtatgtctcatcttccaacaagtttattgtcatcgtttcatcaaaataatcaacttaggttccttaaaaaaaatgatcaacttatcattcttttctgttgctttcaggatgtggcacacgagatttctggagagctgcaggccacccctgacctgatcattgggaactacagtgatggcaaccttgttgcatgtttgctggcacacaagttgggtgtcactcatgtacgaattctagcaccttattcaatacaattttttttatgataagcatagtatttcaattattcactgtagtattcttgttccatcatgtgcagtgtacaatcgcccatgcacttgagaaaaccaagtaccccaactccgacctttactggaagaagtttgaggatcactatcacttctcctgccagttcacagctgacctgattgcaatgaaccatgctgacttcatcatcacaagtaccttccaggagattgctggaaagtaagattttccttttacaaactttctggatatttgtaaatggcataagctgatcttacatcatcatccaattttcagcaaggaaactgtggggcagtatgagtctcacatggcattcacaatgcctggcctttatcgtgttgtccatggtatcgatgtctttgaccccaagttcaacatcgtctctcctggtgctgacatgtccatctacttcccattcaccgaatcacagaagaggctcacctctctccatttagagatagaggagctactcttcagtgatgttgaaaacactgagcacaagtgagtattgtataatcttttaccagtttgagttgtaactcaacatatgcatatcatgcctgttatcttactggactacctctgtaggtttgttctgaaggacaagaagaagccaatcatcttctcgatggctaggctagaccatgtcaagaatttgactggtctggttgagttgtatggtcggaaccctcgcctgcaagagctagtaaaccttgtggttgtctgtggtgaccatggcaaggaatccaaggacaaagaagagcaggctgagttcaagaagatgtttaatctgatcgagcagtacaatttgaatggccacatccgctggatctccgctcagatgaaccgtgtccgcaatggtgagctctaccgctacatctgcgacatgaggggagcctttgtgcaggtgatgaacactgtcaagctatgagctctccaacaaatttgtagtgttagctagttctgattttctcttttctttttgcaaccagcccgctctctatgaggcctttgggctaactgtgattgaggccatgacctgtggtcttccaacatttgcaactgcctatggtggtccagccgagatcatcgtgcacggcgtgtctggctaccacattgatccttaccagaacgacaaggcctcggcgctgctcgtggagttctttgagaagtgtcaggaagacccaaaccactggatcaagatctcgcagggtggacttcagcgcatcgaggagaagtatgcaaaattctcgtcttaccatgttaccatatgatgaagatgaacactatctaggatctaactgagatgttgccacttgatatcgatgcaggtacacatggaagctctactctgagaggctgatgactctctccggtgtctacggtttctggaagtatgtcaccaacctcgacaggcgtgagacacgccgctacctggagatgctgtacgccctcaagtaccgcaagatggtatgcgcaacattatcgcactttccttcatccatttcatctcagcctatagcctttgtgcttattcttgtactgttgctttgtgttcttgtgcaggctaccaccgttccattggccattgagggagaggcctccaccaaatgatctggccttacccggtgaaaagaatgggcaatgggtgctccattgttgcagtgctgatccaggggtgaagaaaaacagaaatcgaggaacgaatgcatccatttagtttctaagggtttagttgatttcagggccagttcttgtggggttttcaatggaagaaattgatgtaatgctctggccttttcatggatactatgaatgaaataaatgaataacaagattctc</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0616800, RefSeq:Os07g0616800

  1. 1.0 1.1 1.2 Cite error: Invalid <ref> tag; no text was provided for refs named ref1