Difference between revisions of "Os02g0650300"
(→Function) |
(→Function) |
||
| Line 4: | Line 4: | ||
===Function=== | ===Function=== | ||
| − | + | OsYSL15 promoter-β-glucuronidase analysis revealed that OsYSL15 expression in roots was dominant in the epidermis/exodermis and phloem cells under conditions of iron deficiency and was detected only in phloem under iron sufficiency. These results strongly suggest that OsYSL15 is the dominant iron(III)-deoxymugineic acid transporter responsible for iron uptake from the rhizosphere and is also responsible for phloem transport of iron. OsYSL15 was also expressed in flowers, developing seeds, and in the embryonic scutellar epithelial cells during seed germination. OsYSL15 knockdown seedlings showed severe arrest in germination and early growth and were rescued by high iron supply. These results demonstrate that rice OsYSL15 plays a crucial role in iron homeostasis during the early stages of growth. | |
| − | |||
| − | |||
| − | |||
| − | These results strongly suggest that OsYSL15 is the dominant iron(III)-deoxymugineic acid transporter responsible for iron uptake from the rhizosphere and is also responsible for phloem transport of iron | ||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
Rice OsYSL15 is an iron-regulated iron(III)-deoxymugineic acid transporter expressed in the roots and is essential for iron uptake in early growth of the seedlings<ref name="pmid:19049971"/>. | Rice OsYSL15 is an iron-regulated iron(III)-deoxymugineic acid transporter expressed in the roots and is essential for iron uptake in early growth of the seedlings<ref name="pmid:19049971"/>. | ||
Revision as of 07:33, 24 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
OsYSL15 promoter-β-glucuronidase analysis revealed that OsYSL15 expression in roots was dominant in the epidermis/exodermis and phloem cells under conditions of iron deficiency and was detected only in phloem under iron sufficiency. These results strongly suggest that OsYSL15 is the dominant iron(III)-deoxymugineic acid transporter responsible for iron uptake from the rhizosphere and is also responsible for phloem transport of iron. OsYSL15 was also expressed in flowers, developing seeds, and in the embryonic scutellar epithelial cells during seed germination. OsYSL15 knockdown seedlings showed severe arrest in germination and early growth and were rescued by high iron supply. These results demonstrate that rice OsYSL15 plays a crucial role in iron homeostasis during the early stages of growth.
Rice OsYSL15 is an iron-regulated iron(III)-deoxymugineic acid transporter expressed in the roots and is essential for iron uptake in early growth of the seedlings[1].
Furthermore, OsYSL16-knockdown plants accumulated more iron in the vascular bundles of the leaves[2].
The rice transcription factor IDEF1 is essential for the early response to iron deficiency, and induces vegetative expression of late embryogenesis abundant genes[3].
Proximal regions of IDEF1-regulated gene promoters also showed enrichment of RY elements (CATGCA), which regulate gene expression during seed maturation[3].
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
- ↑ Inoue, H; Kobayashi, T; Nozoye, T; Takahashi, M; Kakei, Y; Suzuki, K; Nakazono, M; Nakanishi, H; Mori, S; Nishizawa, NK. (2009) Rice OsYSL15 is an iron-regulated iron(III)-deoxymugineic acid transporter expressed in the roots and is essential for iron uptake in early growth of the seedlings.The Journal of biological chemistry 284: 6.
- ↑ Kakei, Y; Ishimaru, Y; Kobayashi, T; Yamakawa, T; Nakanishi, H; Nishizawa, NK. (2012) OsYSL16 plays a role in the allocation of iron.Plant molecular biology 79: 6.
- ↑ 3.0 3.1 Kobayashi, T; Itai, RN; Ogo, Y; Kakei, Y; Nakanishi, H; Takahashi, M; Nishizawa, NK. (2009) The rice transcription factor IDEF1 is essential for the early response to iron deficiency, and induces vegetative expression of late embryogenesis abundant genes.The Plant journal : for cell and molecular biology 60: 6.
Structured Information
| Gene Name |
Os02g0650300 |
|---|---|
| Description |
Oligopeptide transporter OPT superfamily protein |
| Version |
NM_001186167.1 GI:297721466 GeneID:9268232 |
| Length |
1969 bp |
| Definition |
Oryza sativa Japonica Group Os02g0650300, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 2:27086997..27088965 |
| Sequence Coding Region |
27088433..27088646,27088748..27088911 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008395:27086997..27088965 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008395:27086997..27088965 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>actaattctgcaatctgcattcatgacagattgcaactccatgggtttctaaaatattttgggcttagcttattttggagcttcttccaatggttctacacgggaggcaatgcctgtggatttgttcagttccctacttttggtctgaaagcctggaaacaatcattcttctttgattttagcctcacatatgttggtgcggggatgatttgctcacaccttgtgaacctctctaccctccttggtgcggtcatttcatggggaataatgtggccacttatcagcaaacataagggggactggtaccctgcaaacatacctgaaagcagcatgacaagtttgtatggttacaaggtctcatattttctcaatgcttaa</cdnaseq> |
| Protein Sequence |
<aaseq>TNSAICIHDRLQLHGFLKYFGLSLFWSFFQWFYTGGNACGFVQF PTFGLKAWKQSFFFDFSLTYVGAGMICSHLVNLSTLLGAVISWGIMWPLISKHKGDWY PANIPESSMTSLYGYKVSYFLNA</aaseq> |
| Gene Sequence |
<dnaseqindica>320..533#55..218#aattaattgtgctcattgcattattcttgttagacagtcgttgaccctaaatgaactaattctgcaatctgcattcatgacagattgcaactccatgggtttctaaaatattttgggcttagcttattttggagcttcttccaatggttctacacgggaggcaatgcctgtggatttgttcagttccctacttttggtctgaaagcctggaaacaatcgtaagaattatatgctaatttcctaattgttcatcacagatttatataaattgtagcatgcggtgacaaattttctaagtctgaatttgtttggatatcagattcttctttgattttagcctcacatatgttggtgcggggatgatttgctcacaccttgtgaacctctctaccctccttggtgcggtcatttcatggggaataatgtggccacttatcagcaaacataagggggactggtaccctgcaaacatacctgaaagcagcatgacaagtttgtatggttacaaggtctcatattttctcaatgcttaatgtaaaagcagatactacttacaaaaccatcagataacttatgtaaattgctccttttgcagtcgtttttatgcattgctctgattatgggggatggcctgtaccattttgttaaagttaccggtgtcactgctaagagtttacataatagatttaaccgaaaaagtgttagcaacacaggtgagaaaatgaaaccattgcaaattcaactacatggaaatggaatgcctctcacactcttccatcaccttaattttcacatactcataacactgttaatgatggctaaatgaaatgaattgcagcatcagaggagggtgatatggtttcattagatgatctacaacgtgatgaggtattcaagaggggtactgtcccttcttggatggcatacagtggttacttcttgctaagcatcattgcggtaatcaccataccgataatgtttcgacaagtgaagtggtactacgtgatcatagcctacgcgctcggcccggtgctaggattcgccaattcctacggagcagggctcacggacatcaacatggggtacaactacggcaagatcgctctcttcgtctttgcagcttgggctggcaaggacaatggcgtcatagccggccttgtggttggcaccctggtgaagcagctggtgctcgtctctgccgatctgatgcacgatctcaagacgggacatctcaccttgacatcgccgaggtccatgctcgtgggagagctcatcgggacaggcattggctgcttcatcgcgccactgacgttcatgctgttctacagggcgtttgacatcgggaaccccgatggctactggaaggcgccatacgcgctgatctaccgcaacatggcgatcctcgggatcgagggcatctcggcgctgcccaagcactgcctctcgctctccgtcgggttcttcgcgttcgccgtgctcacgaacgtggcgagggacgccctgccggcgaggtacaagaagctcgtgccgctgccgacggcgatggccgtgccgttcctcgtaggggcgagcttcgccatcgacatgtgcgtcgggagcctggtgctgtttgcttggaacaagatgaacaagaaggaggctgccttcatggtgcctgctgttgcgtctgggctcatgtgtggcgatggcatttggaccttcccttcttctatccttgctctcgctaagattaagccaccgatctgcatgaagtttacgcctggaagctaagaggtgtagtgtgtttaatttcatgggtggaggattgcagaaataaacagtgatgattaactgtaaatgtgtcttttggttgtagtgagctgctgtttgcctatgatccaagtcatgtttgtgttttaatttacctatcgaattagctgtgtttgtacacttgtacattttataacttgagaattgtttagtttggcat</dnaseqindica> |
| External Link(s) |
