Difference between revisions of "Os10g0528300"

From RiceWiki
Jump to: navigation, search
(Evolution)
(Evolution)
Line 10: Line 10:
 
===Evolution===
 
===Evolution===
 
Previous research identified a total of 79 GST genes in the rice genome and classified them in various families. On the basis of protein sequence alignment and
 
Previous research identified a total of 79 GST genes in the rice genome and classified them in various families. On the basis of protein sequence alignment and
evolutionary relationship, fifty two (52) GST genes were included in tau, 17 in phi, 4 in zeta, two in DHAR, two in EF1G and one each in theta and tetrachlorohydroquinone dehalogenase (TCHQD) classes.[[File:Fig1.png|200px|Phylogenetic tree|right|based on the coding sequences of cytosolic GSTs, 86 from the monocots rice and maize  and 60 from the dicots soybean and Arabidopsis . A list of the genes used and their accession numbers is included in the
+
evolutionary relationship, fifty two (52) GST genes were included in tau, 17 in phi, 4 in zeta, two in DHAR, two in EF1G and one each in theta and tetrachlorohydroquinone dehalogenase (TCHQD) classes.[[File:Phylogenetic tree.png|200px|Phylogenetic tree|right|based on the coding sequences of cytosolic GSTs, 86 from the monocots rice and maize  and 60 from the dicots soybean and Arabidopsis . A list of the genes used and their accession numbers is included in the
 
Electronic Supplementary Material]]
 
Electronic Supplementary Material]]
  

Revision as of 08:47, 24 May 2014

Os10g0528300 is Oryza sativa Indica Group mRNA for glutathione S-transferase (gstu4 gene).

Annotated Information

Function

Three glutathione S-transferases (GSTs: OsGSTU3, OsGSTU4 and OsGSTU12) that belong to the plant-specific tau class were markedly overexpressed in roots following Cd(Cadmium) exposure.GSTs have been reported to be involved in the direct quenching of Cd ions, forming GSH–Cd complexes (Adamis et al., 2004).The RT-PCR product levels of the osgstu3 and osgstu4 genes in rice roots increase in response to salicylic acid,jasmonic acid and the auxina-naphthalene acetic acid, as well as heavy metals

Expression

Please input expression information here.

Evolution

Previous research identified a total of 79 GST genes in the rice genome and classified them in various families. On the basis of protein sequence alignment and

evolutionary relationship, fifty two (52) GST genes were included in tau, 17 in phi, 4 in zeta, two in DHAR, two in EF1G and one each in theta and tetrachlorohydroquinone dehalogenase (TCHQD) classes.
based on the coding sequences of cytosolic GSTs, 86 from the monocots rice and maize  and 60 from the dicots soybean and Arabidopsis . A list of the genes used and their accession numbers is included in the Electronic Supplementary Material

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os10g0528300

Description

Tau class GST protein 4

Version

NM_001071658.1 GI:115483059 GeneID:4349189

Length

1397 bp

Definition

Oryza sativa Japonica Group Os10g0528300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 10

Location

Chromosome 10:21011686..21013082

Sequence Coding Region

21011756..21012088,21012317..21012703

Expression

GEO Profiles:Os10g0528300

Genome Context

<gbrowseImage1> name=NC_008403:21011686..21013082 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008403:21011686..21013082 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggccggatcaggagacgagctgatgctgctcggcaaatggccaagcccattcgtcaccagggttgagctcgcgctcggcctcaagggcctcagctacgagtacgtcaagcaggacctcgtcaacaagagcgagctcctcctcgcctccaacccggtgcacaagaagatccccgtgctcatccacaacggcaagccggtctgcgagtcgtcaatcatcgtgcagtacatcgacgaggccttccccgacgccggcgccggcgccgccctgctccccgccgacccctacgagcgcgccgtcgctcgcttctgggtcgcctacgtcgacgacaagttcgttccggcatgggtggcgacgttcagaggcaagacggaggaggagaaggcggaggggatgaagcaactgctcgcggcggtggagacgctggagggagccctgaaggattgctccaaggggaagcccttcttcggcggcgacacagtcgggatcgtggacgtcgcgcttggtggcctcatctcgtgggtgaaagcgaccgaggtgctcgctggctccaagatcttcgacgaggagaaggcccctcttttggccgcgtgggcgcagcgcttcggcgagctcgacgtcgccgagaaggtgttgccggatgtcgacggggtggtcgagttcgctaagatgaggctggcagaggcagctgcggctgccgcggcggcttcaaaaaactaa</cdnaseq>

Protein Sequence

<aaseq>MAGSGDELMLLGKWPSPFVTRVELALGLKGLSYEYVKQDLVNKS ELLLASNPVHKKIPVLIHNGKPVCESSIIVQYIDEAFPDAGAGAALLPADPYERAVAR FWVAYVDDKFVPAWVATFRGKTEEEKAEGMKQLLAAVETLEGALKDCSKGKPFFGGDT VGIVDVALGGLISWVKATEVLAGSKIFDEEKAPLLAAWAQRFGELDVAEKVLPDVDGV VEFAKMRLAEAAAAAAAASKN</aaseq>

Gene Sequence

<dnaseqindica>71..403#632..1018#tacgcagcaaaacacaatccaaagcgtgttcatccaatcattctctgttccgctctctcaccccagcgagatggccggatcaggagacgagctgatgctgctcggcaaatggccaagcccattcgtcaccagggttgagctcgcgctcggcctcaagggcctcagctacgagtacgtcaagcaggacctcgtcaacaagagcgagctcctcctcgcctccaacccggtgcacaagaagatccccgtgctcatccacaacggcaagccggtctgcgagtcgtcaatcatcgtgcagtacatcgacgaggccttccccgacgccggcgccggcgccgccctgctccccgccgacccctacgagcgcgccgtcgctcgcttctgggtcgcctacgtcgacgacaaggtaggatagctaagctacctttccttcatttgtgtcacagttcgagctgttatctcaaaacacaaatattagggaatgatctaatatcaaataattcgaaggatgatgctctaaacccaaatcggctagcccactaccttgtgaaactagccagaaaactcccgggcatttctctcgaggtttttatctcactgatgcgatgatgtgttgggtggcgcgtgcgtgcagttcgttccggcatgggtggcgacgttcagaggcaagacggaggaggagaaggcggaggggatgaagcaactgctcgcggcggtggagacgctggagggagccctgaaggattgctccaaggggaagcccttcttcggcggcgacacagtcgggatcgtggacgtcgcgcttggtggcctcatctcgtgggtgaaagcgaccgaggtgctcgctggctccaagatcttcgacgaggagaaggcccctcttttggccgcgtgggcgcagcgcttcggcgagctcgacgtcgccgagaaggtgttgccggatgtcgacggggtggtcgagttcgctaagatgaggctggcagaggcagctgcggctgccgcggcggcttcaaaaaactaagatggatatgtttggttatgtcgtggtaactcccattgtttgggagaaaataatgtgcttgttggaaaaattatttgggagaaactaatgtgcttgttggaaaagaatagatttagttgatttagtgttttttctgtatcagtatcttgatttatgtctgaataatgcaaggaatattcaatgaagtcatgaagatgcttgtcctctgtttattcagtagttaggggatctttttcttctgttggtgtctattagtttgtgtttgcttagctttgtttatactatcgtgaactttctatataagtttttttctgtgtgagttctaaaataattgactataactctttaagtaaaggccggaatgttttattctattatt</dnaseqindica>

External Link(s)

NCBI Gene:Os10g0528300, RefSeq:Os10g0528300