Difference between revisions of "Os08g0566600"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 4: Line 4:
 
===Function===
 
===Function===
 
Please input function information here.
 
Please input function information here.
 +
PGR5(PROTON GRADIENT REGULATION 5)gene is required for PSI cyclic electron transpor.The fucntion of PGR5 as follow
 
  1.In Rice photosystem Ⅰ(PSI),cyclic electron transfer,which is depending on PGR5,helps to restore the balance of the oxidation of chloroplasts.
 
  1.In Rice photosystem Ⅰ(PSI),cyclic electron transfer,which is depending on PGR5,helps to restore the balance of the oxidation of chloroplasts.
 
  2.PGR5 plays an key role in maintaining reduction capability the iron oxide-dependent protein bodies quinone when the rice chloroplast damage.
 
  2.PGR5 plays an key role in maintaining reduction capability the iron oxide-dependent protein bodies quinone when the rice chloroplast damage.

Revision as of 09:00, 24 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. PGR5(PROTON GRADIENT REGULATION 5)gene is required for PSI cyclic electron transpor.The fucntion of PGR5 as follow

1.In Rice photosystem Ⅰ(PSI),cyclic electron transfer,which is depending on PGR5,helps to restore the balance of the oxidation of chloroplasts.
2.PGR5 plays an key role in maintaining reduction capability the iron oxide-dependent protein bodies quinone when the rice chloroplast damage.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

A Killer-Protector System Regulates Both Hybrid Sterility and Segregation Distortion in Rice
 Science, 2012, 337(6100): 1336-1340

Structured Information

Gene Name

Os08g0566600

Description

Similar to PGR5

Version

NM_001069077.1 GI:115477892 GeneID:4346358

Length

1075 bp

Definition

Oryza sativa Japonica Group Os08g0566600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 8

Location

Chromosome 8:28465852..28466926

Sequence Coding Region

28465967..28466239,28466430..28466534

Expression

GEO Profiles:Os08g0566600

Genome Context

<gbrowseImage1> name=NC_008401:28465852..28466926 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008401:28465852..28466926 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcagcagctgcagcatcatccgtgtccctccccggggcgagggctctcccgacgtggtccagctccgtgtccggcgactcgcactcgttggcgctgagctcgtgggcggcgcggcctcggtcggcgcggccactgcgggcgccggcgaggatgggcaacgtgaacgagggcaaggggatcttcgcaccggtggtggtggtggtgcgcaacatcgttggccgcaagcgcttcaaccagctcaggggaaaggccatcgcgctgcactcgcaggtgatcaccgagttctgcaagaccatcggcgccgacgccaagcagaggcagggcttgatccgccttgccaagaagaacggcgagaagctcggtttccttgcctga</cdnaseq>

Protein Sequence

<aaseq>MAAAAASSVSLPGARALPTWSSSVSGDSHSLALSSWAARPRSAR PLRAPARMGNVNEGKGIFAPVVVVVRNIVGRKRFNQLRGKAIALHSQVITEFCKTIGA DAKQRQGLIRLAKKNGEKLGFLA</aaseq>

Gene Sequence

<dnaseqindica>116..388#579..683#actccactccacccaccggattgctaacttgcttcctccgtccgcggccaccactttctcctctcctcctcagagcaagatcattcaagtataatcctgcctcctactagctataatggcagcagctgcagcatcatccgtgtccctccccggggcgagggctctcccgacgtggtccagctccgtgtccggcgactcgcactcgttggcgctgagctcgtgggcggcgcggcctcggtcggcgcggccactgcgggcgccggcgaggatgggcaacgtgaacgagggcaaggggatcttcgcaccggtggtggtggtggtgcgcaacatcgttggccgcaagcgcttcaaccagctcaggggaaaggccatcgcgctgcactcgcaggtacgcacgtctactctactccgatcctcatcaattatagtacactagttttaattaattagctatcatcatctgccatgccatatatataagcaaattttgcaatcaaacatatcaatatgcttgctatctatcttgtgagtgagtgacttgtggccatcgatgatacggacggtactgcttgttgcaggtgatcaccgagttctgcaagaccatcggcgccgacgccaagcagaggcagggcttgatccgccttgccaagaagaacggcgagaagctcggtttccttgcctgatcgacatgcccttcctaattcctactagctcatttgattggtgtggatttcctctctgaatgaatgaatttcctgtagctagctagccagccgcgccttcctccctgcgtataaatgtgtcttgtgcgtacgtatacctcctcttctgaccttcaattccatccatccatgccatggcggcatgaacgaatgaattagtagtaagtaatacgcgcatgcatgaacgaatgaataatatactatataatgcgtgtatacagacactagcgctggctagcatgtatgatgatcatgatgtatatgtatgagactgagactgtatgtagccagttaagcgacatcattgccgtcaagctccaatcggatggatctggatctcctagtcaatcttt</dnaseqindica>

External Link(s)

NCBI Gene:Os08g0566600, RefSeq:Os08g0566600