Difference between revisions of "Os08g0566600"
Longkailian (talk | contribs) (→Annotated Information) |
Longkailian (talk | contribs) (→Function) |
||
| Line 8: | Line 8: | ||
PGR5(PROTON GRADIENT REGULATION 5)gene is required for Rice photosystem I(PSI) cyclic electron transpor.The fucntions of PGR5 as follow: | PGR5(PROTON GRADIENT REGULATION 5)gene is required for Rice photosystem I(PSI) cyclic electron transpor.The fucntions of PGR5 as follow: | ||
| − | 1. | + | 1.PGR5-dependent PSI cyclic electron transporthelps to restore the balance of the oxidation of chloroplasts. |
2.PGR5 plays an key role in maintaining reduction capability the iron oxide-dependent protein bodies quinone when the rice chloroplast damage. | 2.PGR5 plays an key role in maintaining reduction capability the iron oxide-dependent protein bodies quinone when the rice chloroplast damage. | ||
Revision as of 09:52, 24 May 2014
Please input one-sentence summary here.
The rice Os08g0566600 was report as proton gradient regulation 5 ,which is is screened from the Rice Data.
Contents
Annotated Information
Function
PGR5(PROTON GRADIENT REGULATION 5)gene is required for Rice photosystem I(PSI) cyclic electron transpor.The fucntions of PGR5 as follow:
1.PGR5-dependent PSI cyclic electron transporthelps to restore the balance of the oxidation of chloroplasts.
2.PGR5 plays an key role in maintaining reduction capability the iron oxide-dependent protein bodies quinone when the rice chloroplast damage.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
1.Department of Botany, Graduate School of Science, Kyoto University, Sakyo-ku, Kyoto, 606-8502 Japan
2.CREST, Japan Science and Technology Agency, Chiyoda-ku, Tokyo, 102-0076 Japan
3.Department of Applied Plant Science, Graduate School of Agricultural Science, Tohoku University, Sendai, 981-8555 Japan
4.National Institute of Agrobiological Sciences, Tsukuba, Ibaraki, 305-8602 Japan
References
1. PGR5-Dependent Cyclic Electron Transport Around PSI Contributes to the Redox Homeostasis in Chloroplasts Rather Than CO2 Fixation and Biomass Production in Rice Plant and Cell Physiology, 2012, 53(12): 2117-2126
Structured Information
| Gene Name |
Os08g0566600 |
|---|---|
| Description |
Similar to PGR5 |
| Version |
NM_001069077.1 GI:115477892 GeneID:4346358 |
| Length |
1075 bp |
| Definition |
Oryza sativa Japonica Group Os08g0566600, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 8:28465852..28466926 |
| Sequence Coding Region |
28465967..28466239,28466430..28466534 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008401:28465852..28466926 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008401:28465852..28466926 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcagcagctgcagcatcatccgtgtccctccccggggcgagggctctcccgacgtggtccagctccgtgtccggcgactcgcactcgttggcgctgagctcgtgggcggcgcggcctcggtcggcgcggccactgcgggcgccggcgaggatgggcaacgtgaacgagggcaaggggatcttcgcaccggtggtggtggtggtgcgcaacatcgttggccgcaagcgcttcaaccagctcaggggaaaggccatcgcgctgcactcgcaggtgatcaccgagttctgcaagaccatcggcgccgacgccaagcagaggcagggcttgatccgccttgccaagaagaacggcgagaagctcggtttccttgcctga</cdnaseq> |
| Protein Sequence |
<aaseq>MAAAAASSVSLPGARALPTWSSSVSGDSHSLALSSWAARPRSAR PLRAPARMGNVNEGKGIFAPVVVVVRNIVGRKRFNQLRGKAIALHSQVITEFCKTIGA DAKQRQGLIRLAKKNGEKLGFLA</aaseq> |
| Gene Sequence |
<dnaseqindica>116..388#579..683#actccactccacccaccggattgctaacttgcttcctccgtccgcggccaccactttctcctctcctcctcagagcaagatcattcaagtataatcctgcctcctactagctataatggcagcagctgcagcatcatccgtgtccctccccggggcgagggctctcccgacgtggtccagctccgtgtccggcgactcgcactcgttggcgctgagctcgtgggcggcgcggcctcggtcggcgcggccactgcgggcgccggcgaggatgggcaacgtgaacgagggcaaggggatcttcgcaccggtggtggtggtggtgcgcaacatcgttggccgcaagcgcttcaaccagctcaggggaaaggccatcgcgctgcactcgcaggtacgcacgtctactctactccgatcctcatcaattatagtacactagttttaattaattagctatcatcatctgccatgccatatatataagcaaattttgcaatcaaacatatcaatatgcttgctatctatcttgtgagtgagtgacttgtggccatcgatgatacggacggtactgcttgttgcaggtgatcaccgagttctgcaagaccatcggcgccgacgccaagcagaggcagggcttgatccgccttgccaagaagaacggcgagaagctcggtttccttgcctgatcgacatgcccttcctaattcctactagctcatttgattggtgtggatttcctctctgaatgaatgaatttcctgtagctagctagccagccgcgccttcctccctgcgtataaatgtgtcttgtgcgtacgtatacctcctcttctgaccttcaattccatccatccatgccatggcggcatgaacgaatgaattagtagtaagtaatacgcgcatgcatgaacgaatgaataatatactatataatgcgtgtatacagacactagcgctggctagcatgtatgatgatcatgatgtatatgtatgagactgagactgtatgtagccagttaagcgacatcattgccgtcaagctccaatcggatggatctggatctcctagtcaatcttt</dnaseqindica> |
| External Link(s) |