Difference between revisions of "Os08g0566600"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Function)
Line 8: Line 8:
 
PGR5(PROTON GRADIENT REGULATION 5)gene is required for Rice photosystem I(PSI) cyclic electron transpor.The fucntions of PGR5 as follow:
 
PGR5(PROTON GRADIENT REGULATION 5)gene is required for Rice photosystem I(PSI) cyclic electron transpor.The fucntions of PGR5 as follow:
  
1.Cyclic electron transfer,which is depending on PGR5,helps to restore the balance of the oxidation of chloroplasts.
+
1.PGR5-dependent PSI cyclic electron transporthelps to restore the balance of the oxidation of chloroplasts.
  
 
2.PGR5 plays an key role in maintaining reduction capability the iron oxide-dependent protein bodies quinone when the rice chloroplast damage.
 
2.PGR5 plays an key role in maintaining reduction capability the iron oxide-dependent protein bodies quinone when the rice chloroplast damage.

Revision as of 09:52, 24 May 2014

Please input one-sentence summary here.

The rice Os08g0566600 was report as proton gradient regulation 5 ,which is is screened from the Rice Data.


Annotated Information

Function

PGR5(PROTON GRADIENT REGULATION 5)gene is required for Rice photosystem I(PSI) cyclic electron transpor.The fucntions of PGR5 as follow:

1.PGR5-dependent PSI cyclic electron transporthelps to restore the balance of the oxidation of chloroplasts.

2.PGR5 plays an key role in maintaining reduction capability the iron oxide-dependent protein bodies quinone when the rice chloroplast damage.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

1.Department of Botany, Graduate School of Science, Kyoto University, Sakyo-ku, Kyoto, 606-8502 Japan

2.CREST, Japan Science and Technology Agency, Chiyoda-ku, Tokyo, 102-0076 Japan

3.Department of Applied Plant Science, Graduate School of Agricultural Science, Tohoku University, Sendai, 981-8555 Japan

4.National Institute of Agrobiological Sciences, Tsukuba, Ibaraki, 305-8602 Japan

References

1. PGR5-Dependent Cyclic Electron Transport Around PSI Contributes to the Redox Homeostasis in Chloroplasts Rather Than CO2 Fixation and Biomass Production in Rice Plant and Cell Physiology, 2012, 53(12): 2117-2126

Structured Information

Gene Name

Os08g0566600

Description

Similar to PGR5

Version

NM_001069077.1 GI:115477892 GeneID:4346358

Length

1075 bp

Definition

Oryza sativa Japonica Group Os08g0566600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 8

Location

Chromosome 8:28465852..28466926

Sequence Coding Region

28465967..28466239,28466430..28466534

Expression

GEO Profiles:Os08g0566600

Genome Context

<gbrowseImage1> name=NC_008401:28465852..28466926 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008401:28465852..28466926 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcagcagctgcagcatcatccgtgtccctccccggggcgagggctctcccgacgtggtccagctccgtgtccggcgactcgcactcgttggcgctgagctcgtgggcggcgcggcctcggtcggcgcggccactgcgggcgccggcgaggatgggcaacgtgaacgagggcaaggggatcttcgcaccggtggtggtggtggtgcgcaacatcgttggccgcaagcgcttcaaccagctcaggggaaaggccatcgcgctgcactcgcaggtgatcaccgagttctgcaagaccatcggcgccgacgccaagcagaggcagggcttgatccgccttgccaagaagaacggcgagaagctcggtttccttgcctga</cdnaseq>

Protein Sequence

<aaseq>MAAAAASSVSLPGARALPTWSSSVSGDSHSLALSSWAARPRSAR PLRAPARMGNVNEGKGIFAPVVVVVRNIVGRKRFNQLRGKAIALHSQVITEFCKTIGA DAKQRQGLIRLAKKNGEKLGFLA</aaseq>

Gene Sequence

<dnaseqindica>116..388#579..683#actccactccacccaccggattgctaacttgcttcctccgtccgcggccaccactttctcctctcctcctcagagcaagatcattcaagtataatcctgcctcctactagctataatggcagcagctgcagcatcatccgtgtccctccccggggcgagggctctcccgacgtggtccagctccgtgtccggcgactcgcactcgttggcgctgagctcgtgggcggcgcggcctcggtcggcgcggccactgcgggcgccggcgaggatgggcaacgtgaacgagggcaaggggatcttcgcaccggtggtggtggtggtgcgcaacatcgttggccgcaagcgcttcaaccagctcaggggaaaggccatcgcgctgcactcgcaggtacgcacgtctactctactccgatcctcatcaattatagtacactagttttaattaattagctatcatcatctgccatgccatatatataagcaaattttgcaatcaaacatatcaatatgcttgctatctatcttgtgagtgagtgacttgtggccatcgatgatacggacggtactgcttgttgcaggtgatcaccgagttctgcaagaccatcggcgccgacgccaagcagaggcagggcttgatccgccttgccaagaagaacggcgagaagctcggtttccttgcctgatcgacatgcccttcctaattcctactagctcatttgattggtgtggatttcctctctgaatgaatgaatttcctgtagctagctagccagccgcgccttcctccctgcgtataaatgtgtcttgtgcgtacgtatacctcctcttctgaccttcaattccatccatccatgccatggcggcatgaacgaatgaattagtagtaagtaatacgcgcatgcatgaacgaatgaataatatactatataatgcgtgtatacagacactagcgctggctagcatgtatgatgatcatgatgtatatgtatgagactgagactgtatgtagccagttaagcgacatcattgccgtcaagctccaatcggatggatctggatctcctagtcaatcttt</dnaseqindica>

External Link(s)

NCBI Gene:Os08g0566600, RefSeq:Os08g0566600